KEGG   Streptomyces coelicolor: SCO5999Help
Entry
SCO5999           CDS       T00085                                 

Gene name
sacA, SCBAC1C11.02
Definition
(RefSeq) aconitate hydratase
  KO
K01681  aconitate hydratase [EC:4.2.1.3]
Organism
sco  Streptomyces coelicolor
Pathway
sco00020  Citrate cycle (TCA cycle)
sco00630  Glyoxylate and dicarboxylate metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
sco01210  2-Oxocarboxylic acid metabolism
sco01230  Biosynthesis of amino acids
Module
sco_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sco_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
sco_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCO5999 (sacA)
   00630 Glyoxylate and dicarboxylate metabolism
    SCO5999 (sacA)
Enzymes [BR:sco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.3  aconitate hydratase
     SCO5999 (sacA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-GeneID: 1101441
NCBI-ProteinID: NP_630114
Kitasato: SCO5999
UniProt: Q7AKF3
Position
6575305..6578019
Genome map
AA seq 904 aa AA seqDB search
MSANSFDARSTLQVGDESYEIFRLDKVEGSARLPYSLKVLLENLLRTEDGANITADHIRA
LGGWDSQAQPSQEIQFTPARVIMQDFTGVPCVVDLATMREAVKELGGDPNKINPLSPAEM
VIDHSVIADKFGTNDAFQQNVDLEYGRNKERYQFLRWGQTAFDDFKVVPPGTGIVHQVNI
EHLARVVMTRDGKAYPDTLVGTDSHTTMVNGLGVLGWGVGGIEAEAAMLGQPVSMLIPRV
VGFKLTGELTPGTTATDLVLTITEMLRKHGVVGKFVEFYGEGVAATSLANRATIGNMSPE
FGSTAAIFPVDDETLNYMRLTGRSAHQVALVEAYAKEQGLWLDPKAEPDFSEKLELDLST
VVPSIAGPKRPQDRIVLANAAEQFKQDVRNYVDSVDEAGQESFPASDAPAVTNGVPSNPV
PVTAPDGTTYELDHGAVTVAAITSCTNTSNPYVMVAAALVAKKAVEKGLTRKPWVKTTLA
PGSKVVTDYFEKAGLTPYLDKVGFNLVGYGCTTCIGNSGPLPDEVSKAVNDHDLAVTSVL
SGNRNFEGRINPDVKMNYLASPPLVVAYALAGSMKVDVTKDALGVDQDGNPVFLKDIWPS
EAEVNDVVANAIGEDMFSKSYSDVFAGDAQWQALSIPTGDTFEWDGESTYVRKPPYFEGM
GMEPAPVEDISGARVLAKLGDSVTTDHISPAGAIKADTPAGKYLTEHGVERRDFNSYGSR
RGNHEIMIRGTFANIRLRNQIAPGTEGGYTRDFTQDGGPVSFIYDASRNYIEQGTPLVVL
AGKEYGSGSSRDWAAKGTALLGVKAVVAESYERIHRSNLIGMGVLPLQFPEGHTAESLGL
TGEETFSVSGVTELNEGTTPRTVKVTTDTGVEFDAVVRIDTPGEADYYRNGGILQYVLRS
LIRK
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
gtgtcggcgaacagcttcgacgcccgcagcacactgcaggtgggcgacgagtcgtacgag
atcttccggctggacaaggtcgagggctccgcgcgccttccctacagcctgaaggtgctg
ctggagaacctgctccgcaccgaggacggcgcgaacatcaccgccgaccacatccgcgcc
ctcggcgggtgggactcgcaggcccagccgtcgcaggagatccagttcacgccggcccgc
gtgatcatgcaggacttcaccggcgtgccctgtgtcgtcgacctcgccaccatgcgcgag
gccgtcaaggagctgggcggcgacccgaacaagatcaacccgctgtccccggccgagatg
gtcatcgaccactccgtcatcgcggacaagttcggcaccaacgacgccttccagcagaac
gtcgacctggagtacggccgcaacaaggagcgctaccagttcctgcgctggggccagacc
gccttcgacgacttcaaggtcgtccccccgggcaccggcatcgtccaccaggtgaacatc
gagcacctggcccgcgtcgtcatgacccgtgacggcaaggcctaccccgacaccctggtc
ggcaccgactcgcacaccaccatggtcaacggcctcggcgtcctcggctggggcgtcggc
ggcatcgaggccgaggccgcgatgctcggccagccggtctccatgctgatcccgcgcgtc
gtcggcttcaagctcaccggcgagctgacccccggcaccaccgccaccgacctggtgctc
acgatcaccgagatgctgcgcaagcacggcgtcgtcggcaagttcgtcgagttctacggc
gagggcgtggccgccacgtcgctggccaaccgcgccaccatcggcaacatgtcgccggag
ttcggctccaccgccgcgatcttcccggtcgacgacgagacgctgaactacatgcgcctg
accggccgctccgcgcatcaggtcgcgctcgtcgaggcgtacgccaaggagcagggcctc
tggctggacccgaaggccgagccggacttctccgagaagctggagctggacctctccacg
gtcgtcccctccatcgccggcccgaagcgcccgcaggaccgcatcgtcctcgccaacgcc
gccgagcagttcaagcaggacgtgcgcaactacgtcgacagcgtggacgaggcgggccag
gagtccttcccggcctccgacgcccccgccgtcaccaacggcgtaccgtccaacccggtc
ccggtcaccgcccccgacggcaccacctacgagctggaccacggcgcggtgacggtcgcg
gccatcacctcctgcaccaacacctccaacccgtacgtcatggtcgccgccgccctggtg
gccaagaaggcggtcgagaagggcctgacccgcaagccgtgggtcaagaccaccctcgcc
ccgggctccaaggtcgtcaccgactacttcgagaaggcgggcctgaccccctacctcgac
aaggtcggcttcaacctggtcggctacggctgcaccacctgcatcggcaactccggcccg
ctgccggacgaggtctccaaggccgtcaacgaccacgacctcgccgtcacctcggtgctc
tccggcaaccgcaacttcgagggccggatcaaccccgacgtcaagatgaactacctggcg
tccccgccgctggtcgtcgcctacgcgctcgcgggctccatgaaggtggacgtcaccaag
gacgccctgggcgtcgaccaggacggcaacccggtcttcctcaaggacatctggccctcc
gaggccgaggtcaacgacgtcgtcgccaacgccatcggcgaggacatgttctccaagtcc
tacagcgacgtcttcgcgggcgacgcccagtggcaggcgctgtccatcccgaccggcgac
accttcgagtgggacggcgagtccacctacgtgcgcaagcccccgtacttcgagggcatg
ggcatggagccggccccggtcgaggacatctccggcgcccgggtgctcgccaagctcggc
gactcggtgaccacggaccacatctcgcccgccggcgccatcaaggccgacaccccggcc
ggcaagtacctgacggagcacggcgtcgagcgccgcgacttcaacagctacggctcgcgc
cgcggcaaccacgagatcatgatccgcggcaccttcgccaacatccgcctgcgcaaccag
atcgcgccgggcaccgagggcggctacacccgcgacttcacccaggacggcggtccggtg
tcgttcatctacgacgcctcccgcaactacatcgagcagggcaccccgctcgtcgtcctg
gccggcaaggagtacggctccggctcgtcccgcgactgggccgccaagggcaccgcgctc
ctcggcgtcaaggcggtcgtcgccgagtcctacgagcgcatccaccgctcgaacctcatc
ggcatgggcgtcctgccgctccagttcccggagggccacaccgccgagtccctcggcctg
accggtgaggagaccttctccgtctccggcgtgaccgagctgaacgagggcaccaccccg
cgcacggtgaaggtcaccaccgacaccggcgtcgagttcgacgcggtcgtgcgcatcgac
acccccggcgaggcggactactaccgcaacggcggcatcctgcagtacgtgctgcgcagc
ctgatccgcaagtag

DBGET integrated database retrieval system