KEGG   Streptomyces coelicolor: SCO6102Help
Entry
SCO6102           CDS       T00085                                 

Gene name
SCBAC1A6.26c
Definition
(RefSeq) nitrite/sulfite reductase
  KO
K00392  sulfite reductase (ferredoxin) [EC:1.8.7.1]
Organism
sco  Streptomyces coelicolor
Pathway
sco00920  Sulfur metabolism
sco01100  Metabolic pathways
sco01120  Microbial metabolism in diverse environments
Module
sco_M00176  Assimilatory sulfate reduction, sulfate => H2S
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    SCO6102 (SCBAC1A6.26c)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.7  With an iron-sulfur protein as acceptor
    1.8.7.1  assimilatory sulfite reductase (ferredoxin)
     SCO6102 (SCBAC1A6.26c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NIR_SIR NIR_SIR_ferr
Motif
Other DBs
NCBI-GeneID: 1101543
NCBI-ProteinID: NP_630210
Kitasato: SCO6102
UniProt: Q9ADG1
Position
complement(6700888..6702585)
Genome map
AA seq 565 aa AA seqDB search
MAATPPKPAAATPRRKVSRHRGEGQWAAGHFTPLNGNEQTKKDDDGLNVRTRIETIYSKR
GFDSIDPGDLRGRMRWWGLYTQRRQGIDGGKTAILEPEELDDRYFMLRVRIDGGALTTAQ
LRVVGEISQEFARGTADITDRQNVQYHWIRIEDVPEIWNRLEGVGLSTVTACGDTPRVMI
ASPVAGIAEDEIIDGTPALEEMKRRVLNNPAYSNLPRKFKTAISGSPVQDVVHEINDVAF
VGVEHPEHGPGFDLWVGGGLSTNPKLGVRLNAWVPIDDVPDVYEGVISIFRDYGYRRLRN
RARLKFLVADWGAEKFRQVLEDEYLKRKLTDGPAPAEPSSRWRDHIGVHRQKDGRYYVGF
APRVGRVDGTILTKVADLAEAHGSGRVRTTVEQKMIVLDVEEGRVDSLVESLEALDLSAR
PSTFRRGTMACTGIEFCKLAIVETKARGASLIDELERRLPDFDEPLTINLNGCPNACARI
QTADIGLKGQLMLDEHGEQVEGYQVHLGGALGLEAGFGRKVRGLKVTAQELPDYVERVLK
RFQAEREDGERFAAWAARASEEALS
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atggccgccactccgccgaagcccgctgccgcgaccccgcgccgcaaggtgagccgtcac
cgcggcgagggccagtgggcggccgggcacttcaccccgctcaacggcaacgagcagacc
aagaaggacgacgacggtctcaacgttcggacacgtattgagacgatctactccaagcgc
ggcttcgactcgatcgaccccggcgacctgcgcggccgtatgcgctggtgggggctgtac
acccagcgtcgccagggcatcgacggcggcaagacggcgatcctcgagccggaggagctg
gacgaccgctacttcatgctccgcgtccgcatcgacggcggcgccctgaccacggctcag
ctgcgtgtcgtcggcgagatctcgcaggagttcgcgcgcggcacggccgacatcaccgac
cggcagaacgtccagtaccactggatccggatcgaggacgtgccggagatctggaaccgc
ctggagggcgtcggcctgtccacggtgaccgcctgcggtgacacgccccgcgtgatgatc
gcctcccccgtggcgggcatcgccgaggacgagatcatcgacggcacaccggcgctggag
gagatgaagcgccgggtcctgaacaacccggcgtactcgaacctcccccgcaagttcaag
accgcgatctccgggtcgccggtgcaggacgtcgtgcacgagatcaacgacgtggccttc
gtcggggtcgagcaccccgagcacggtccgggcttcgacctgtgggtgggcggcgggctg
tccaccaaccccaagctgggcgtgcggctgaacgcctgggtgccgatcgacgacgtgccc
gacgtctacgagggcgtcatctccatcttccgcgactacggctaccggcggctgcgcaac
cgcgcccgcctgaagttcctggtcgccgactggggcgcggagaagttccgtcaggtgctg
gaggacgagtacctgaagcggaagctgaccgacgggccggcacccgccgagcccagcagc
cgctggcgcgaccacatcggtgtgcaccgccagaaggacggccgctactacgtcggcttc
gccccgcgcgtgggccgcgtcgacggcaccatcctgaccaaggtcgccgacctggcggag
gcgcacggctcgggccgggtgcgcaccacggtcgagcagaagatgatcgtcctcgacgtc
gaggaggggcgggtcgactcgctggtggagtccctggaggcgctggacctcagcgccagg
ccctccaccttccggcgcggcaccatggcctgcacgggcatcgagttctgcaagctcgcc
atcgtcgagaccaaggcgcgcggcgcctcgctcatcgacgagctggagcgccgcctcccc
gacttcgacgagcccctcaccatcaatctcaacggctgcccgaacgcctgcgcccgcatc
cagaccgcggacatcggtctcaagggccagctcatgctcgacgagcacggcgagcaggtc
gagggctaccaggtgcacctgggcggcgccctcggcctggaggccggcttcgggcgcaag
gtgcgcggcctgaaggtcaccgcccaggaactgccggactacgtggagcgcgtcctcaag
cgcttccaggccgaacgcgaggacggcgagcgcttcgccgcctgggcggcccgggcctcc
gaggaggccctgtcgtga

DBGET integrated database retrieval system