KEGG   Streptomyces coelicolor: SCO6195Help
Entry
SCO6195           CDS       T00085                                 

Gene name
SC2G5.16
Definition
(RefSeq) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sco  Streptomyces coelicolor
Pathway
sco00010  Glycolysis / Gluconeogenesis
sco00620  Pyruvate metabolism
sco00630  Glyoxylate and dicarboxylate metabolism
sco00640  Propanoate metabolism
sco00680  Methane metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO6195 (SC2G5.16)
   00620 Pyruvate metabolism
    SCO6195 (SC2G5.16)
   00630 Glyoxylate and dicarboxylate metabolism
    SCO6195 (SC2G5.16)
   00640 Propanoate metabolism
    SCO6195 (SC2G5.16)
  09102 Energy metabolism
   00680 Methane metabolism
    SCO6195 (SC2G5.16)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sco01004]
    SCO6195 (SC2G5.16)
Enzymes [BR:sco01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SCO6195 (SC2G5.16)
Lipid biosynthesis proteins [BR:sco01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SCO6195 (SC2G5.16)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 1101636
NCBI-ProteinID: NP_630298
Kitasato: SCO6195
UniProt: Q9Z5A7
Position
6804196..6805872
Genome map
AA seq 558 aa AA seqDB search
MTTATELFRTARDFLLEHREDYTAAYEGFRWPRPANFNWALDWFDVVAEGNGRTALHIVE
EDGREVRVSFAEMSARSNRVANRLREWGVGPEDRILVMLGNQAELWETALAAMKLRAVVI
PATTLLGPADLRDRVDRGRVGHVIARAEDTGKFDDVPGHYTRVAVGGATPAAGWRAYEDV
YGASDTFTPDGPTAADDPLMLYFTSGTTARPKLVEHTHVSYPVGHLATMYWIGLKPGDVH
LNISSPGWAKHAWSNLFAPWNAEATVFLYNYTRFDATRLMAEMDRAGVTTFCAPPTVWRM
LIQADLTRLATPPREVVAAGEPLNPEVIEQVRRLWGRTIRDGFGQTETAVQVSNSPGQVL
KTGSMGRPSPGYRVELLDPVTGAPGAAEGEIALDLSDHPVGLMTGYHGDPDRTAEAMAGG
YYRTGDIGARDEDGYLTYVGRADDVFKASDYKISPFELESALLEHEAVAEAAVVPAPDAL
RLAVPKAYIVLAAGWEPGPDTAKVLFEHSRDTLAAYKRVRRLEFGELPKTVSGKIRRIEL
REATAAGSANEYREEDFR
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgacgacggccacggagctgttccgcaccgcacgggacttcctgctggaacaccgcgag
gactacaccgccgcctacgaggggttccggtggccccgccccgcgaacttcaactgggcg
ctggactggttcgacgtcgtcgccgagggcaacgggcgcaccgccctgcacatcgtcgag
gaggacggccgcgaggtccgggtctccttcgccgagatgtccgcccgctccaaccgggtc
gcgaaccgcctgcgcgaatggggcgtcggtccggaggaccgcatcctcgtgatgctcggc
aaccaggccgagctgtgggagaccgcgctggccgcgatgaaactgcgcgcggtcgtcatc
ccggccaccaccctgctcggccccgccgacctgcgcgaccgcgtcgaccgcggccgggtc
gggcacgtgatcgcgcgcgccgaggacaccggcaagttcgacgacgtgcccggccactac
acgcgcgtcgccgtgggcggcgcaacgccggccgccggctggcgggcctacgaggacgtg
tacggcgcctccgacaccttcaccccggacggcccgaccgccgccgacgacccgctgatg
ctgtacttcacctccggcaccaccgcccgccccaaactggtcgagcacacccacgtgtcg
taccccgtcggccacctggcgaccatgtactggatcgggctcaagcccggcgacgtgcac
ctcaacatctcctcgcccggctgggccaagcacgcctggtcgaacctgttcgcgccgtgg
aacgccgaggccaccgtcttcctgtacaactacacgcggttcgacgcgacccgcctgatg
gccgagatggaccgggccggggtgaccaccttctgcgccccgcccaccgtgtggcgcatg
ctcatccaggccgacctcacccggctcgccaccccgccgcgcgaggtcgtcgccgccggt
gagccgctcaaccccgaggtgatcgaacaggtccgccgcctgtgggggaggaccatccgg
gacggcttcggccagaccgagaccgccgtccaggtctccaacagccccggccaggtgctg
aagaccggctcgatgggccgccccagccccggctaccgcgtcgagctgctcgatccggtg
accggcgcgcccggcgccgccgagggcgagatcgccctggacctgtccgaccaccccgtg
ggcctgatgaccggctaccatggcgaccccgaccgcaccgccgaggcgatggccggcggc
tactaccgcaccggcgacatcggcgcccgcgacgaggacggctacctcacctacgtgggc
cgggccgacgacgtgttcaaggcctccgactacaagatcagccccttcgagctggagagc
gcgctgctggagcacgaggcggtcgccgaggccgcggtcgtgcccgccccggacgcactg
cgcctcgcggtgccgaaggcgtacatcgtgctcgcggcgggctgggagcccggaccggac
accgcgaaggtgctcttcgagcactcccgcgacacgctcgccgcctacaagcgggtgcgc
cgcctggagttcggcgagctgcccaagaccgtctcgggcaagatccgccgcatcgaactg
cgggaggccacggcggccggttccgcgaacgagtaccgcgaggaggacttccggtga

DBGET integrated database retrieval system