KEGG   Streptomyces coelicolor: SCO6204Help
Entry
SCO6204           CDS       T00085                                 

Gene name
SC2G5.25c
Definition
(RefSeq) catalase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
sco  Streptomyces coelicolor
Pathway
sco00380  Tryptophan metabolism
sco00630  Glyoxylate and dicarboxylate metabolism
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SCO6204 (SC2G5.25c)
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    SCO6204 (SC2G5.25c)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     SCO6204 (SC2G5.25c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel
Motif
Other DBs
NCBI-GeneID: 1101645
NCBI-ProteinID: NP_630307
Kitasato: SCO6204
UniProt: Q9Z598
Position
complement(6818863..6820326)
Genome map
AA seq 487 aa AA seqDB search
MSQRVLTTESGAPVADNQNSASAGIGGPLLIQDQHLIEKLARFNRERIPERVVHARGSGA
YGHFEVTDDVSGFTHADFLNTVGKRTEVFLRFSTVADSLGGADAVRDPRGFALKFYTEEG
NYDLVGNNTPVFFIKDPIKFPDFIHSQKRDPFTGRQEPDNVFDFWAHSPEATHQITWLMG
DRGIPASYRHMDGFGSHTYQWTNARGESFFVKYHFKTDQGIRCLTADEAAKLAGEDPTSH
QTDLVQAIERGVYPSWTLHVQLMPVAEAANYRFNPFDVTKVWPHADYPLKRVGRLVLDRN
PDNVFAEVEQAAFSPNNFVPGIGPSPDKMLQGRLFAYADAHRYRLGVNHTQLAVNAPKAV
PGGAANYGRDGLMAANPQGRYAKNYEPNSYDGPAETGTPLAAPLAVSGHTGTHEAPLHTK
DDHFVQAGALYRLMSEDEKQRLVANLAGGLSQVSRNDVVEKNLAHFHAADPEYGKRVEEA
VRALRED
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagcgcgtgctcaccaccgagtccggcgccccggtcgccgacaaccagaactcc
gcttccgccggcatcggcggccccctcctgatccaggaccagcacctcatcgagaagctc
gcccggttcaaccgcgagcgcatcccggagcgcgtggtgcacgcccgcggctccggcgcc
tacggccacttcgaggtcaccgacgacgtcagcggcttcacccacgccgacttcctgaac
acggtcggcaagcgcaccgaggtcttcctgcgcttctccacggtggccgactcgctcggc
ggcgcggacgcggtccgcgacccgcggggcttcgcgctgaagttctacaccgaggagggc
aactacgacctcgtcggcaacaacaccccggtgttcttcatcaaggaccccatcaagttc
ccggacttcatccactcgcagaagcgcgacccgttcacgggccgtcaggagccggacaac
gtcttcgacttctgggcgcactcccccgaggcgacgcaccagatcacctggctgatgggc
gaccgcggcatcccggcctcgtaccgccacatggacggcttcggctcgcacacctaccag
tggacgaacgccaggggcgagtccttcttcgtcaagtaccacttcaagacggaccagggc
atccgctgcctgaccgccgacgaggccgcgaagctcgcgggcgaggacccgacctcgcac
cagacggacctggtgcaggcgatcgagcggggcgtgtacccgtcctggacgctgcacgtg
cagctgatgccggtggccgaggcggcgaactaccgcttcaacccgttcgacgtgaccaag
gtgtggccgcacgccgactacccgctcaagcgggtcggccggctggtgctcgaccgcaac
ccggacaacgtcttcgcggaggtcgagcaggccgcgttctccccgaacaacttcgtcccc
ggcatcggtccctcccccgacaagatgctccagggccgcctgttcgcctacgcggacgcg
caccgctaccgcctgggcgtcaaccacacccagctcgcggtgaacgccccgaaggccgtg
cccggcggcgccgccaactacggccgcgacggcctgatggcggccaacccgcagggccgg
tacgccaagaactacgagccgaactcctacgacggcccggccgagaccggcacgccgctg
gcggctccgctcgcggtgtccggccacaccggcacccacgaggcgccgctgcacaccaag
gacgaccacttcgtgcaggccggtgcgctgtaccggctgatgagcgaggacgagaagcag
cgcctggtcgcgaacctggccggcggtctgtcccaggtctcgcgcaacgacgtcgtcgag
aagaacctcgcacacttccacgcggccgaccccgagtacggcaagcgcgtggaggaggcg
gtccgcgccctgcgcgaggactga

DBGET integrated database retrieval system