KEGG   Streptomyces coelicolor: SCO6205Help
Entry
SCO6205           CDS       T00085                                 

Gene name
SC2G5.26c
Definition
(RefSeq) 2-hydroxy-3-oxopropionate reductase
  KO
K00042  2-hydroxy-3-oxopropionate reductase [EC:1.1.1.60]
Organism
sco  Streptomyces coelicolor
Pathway
sco00630  Glyoxylate and dicarboxylate metabolism
sco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SCO6205 (SC2G5.26c)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.60  2-hydroxy-3-oxopropionate reductase
     SCO6205 (SC2G5.26c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_2 NAD_binding_11 F420_oxidored 2-Hacid_dh_C IlvN 3HCDH_N PDH UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-GeneID: 1101646
NCBI-ProteinID: NP_630308
Kitasato: SCO6205
UniProt: Q9Z597
Position
complement(6820531..6821421)
Genome map
AA seq 296 aa AA seqDB search
MSTLPKVAWIGLGIMGSPMSENLIKAGYQVTGFTLEQEKLDRLAAAGGGVAGSIAEAVRD
ADVVVTMVPASPQVEAIAYGPDGILENAKSGALLVDMSSITPQTSVDLAKAAKDKGIRVL
DAPVSGGEAGAIEAVLSIMVGGEQADFDEAKPLLEALGKTIVLCGPHGSGQTVKAANQLI
VAVNIQACAEAVVFLEKSGVDLKAALDVLNGGLAGSTVLTRKKDNFLGRDFKPGFRIDLH
HKDMGIVTDAARNVGAALPVGAVVAQLVASLRAQGDGGLDHSALLRAVERLSGDQV
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgctccccaaggtcgcctggatcggtctcggcatcatgggctcgcccatgtcc
gagaacctgatcaaggcgggttaccaggtcaccggcttcaccctggagcaggagaagctg
gaccgcctcgccgccgccggcggcggcgtggccggttcgatcgccgaggccgtccgcgac
gccgacgtcgtcgtgaccatggtgcccgcgtcgccgcaggtcgaggccatcgcctacggc
cccgacggcatcctggagaacgcgaagtccggcgcactgctggtcgacatgtcctcgatc
accccgcagacctcggtggacctcgcgaaggccgcgaaggacaagggcatccgcgtcctg
gacgcccccgtctccggtggcgaggccggtgcgatcgaggccgtgctgtccatcatggtc
ggcggcgagcaggccgacttcgacgaggccaagccgctcctggaggcgctcggcaagacc
atcgtgctgtgcggtccgcacggctcgggccagaccgtgaaggccgccaaccagctgatc
gtcgccgtcaacatccaggcgtgcgccgaggccgtggtcttcctggagaagtccggcgtg
gacctgaaggccgccctggacgtcctcaacggcggcctggccggctcgaccgtgctgacg
cggaagaaggacaacttcctcggccgcgacttcaagccgggcttccgcatcgacctgcac
cacaaggacatgggcatcgtcaccgacgccgcccgcaacgtgggcgccgcgctgccggtg
ggcgccgtggtggcccagctggtcgcctcgctgcgcgcccagggcgacggcggcctggac
cactcggcgctgctgcgcgccgtggagcgcctctccggcgaccaggtctga

DBGET integrated database retrieval system