KEGG   Streptomyces coelicolor: SCO6248Help
Entry
SCO6248           CDS       T00085                                 

Gene name
SCAH10.13
Definition
(RefSeq) allantoicase
  KO
K01477  allantoicase [EC:3.5.3.4]
Organism
sco  Streptomyces coelicolor
Pathway
sco00230  Purine metabolism
sco01100  Metabolic pathways
sco01120  Microbial metabolism in diverse environments
Module
sco_M00546  Purine degradation, xanthine => urea
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SCO6248 (SCAH10.13)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.4  allantoicase
     SCO6248 (SCAH10.13)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Allantoicase
Motif
Other DBs
NCBI-GeneID: 1101689
NCBI-ProteinID: NP_630348
Kitasato: SCO6248
UniProt: Q9RKU4
Position
6871127..6872257
Genome map
AA seq 376 aa AA seqDB search
MTAQQNTSLASFTGDAQPYGGGDPYADYRTADLPFTQYANLADRQLGAGVVAANDEFFAQ
RENLLVPEPAEFDPEHFGHKGKVMDGWETRRRRGVSAEQPWPTEEDHDWALIRLGAPGVI
RGIVVDTAHFRGNYPQAVSVEGASVAGSPSPEELLADDVKWTTLVPRTPVGGHAANGFAV
SAEQRFTHLRLKQHPDGGIARLRVYGEVVADPAWLAALGTFDVVALENGGQVEDASNLFY
SPATNTIQPGRSRKMDDGWETRRRRDKGNDWIQYRLVDRSQIRAIEIDTAYLKGNSAGWA
SVSVKDGEAGEWREVLPRTRMQPDTNHRFVLPEAAVGTHARVDIFPDGGISRLRLFGSLT
EDGAARLAARHQELGG
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
gtgacggcccagcagaacacctcgttggccagcttcaccggcgacgcccagccctacgga
ggcggcgacccgtacgcggactaccgcaccgccgacctccccttcacccagtacgccaac
cttgccgaccggcagctcggcgcgggtgtcgtcgccgccaacgacgagttcttcgcccag
cgcgagaacctgctggtgcccgagcccgccgagttcgaccccgagcacttcgggcacaag
ggcaaggtcatggacggctgggagacccgccggcgccgcggcgtctcggccgagcagccc
tggcccaccgaggaggaccacgactgggcgctgatccgcctcggcgcccccggcgtgatc
cgcggcatcgtcgtcgacaccgcccacttccgcggcaactacccgcaggccgtctccgtc
gagggcgcctcggtcgcgggctccccctccccggaggaactgctcgcggacgacgtgaag
tggacgaccctcgtcccgcgcaccccggtcggcggccacgcggccaacggcttcgccgtc
tcggccgagcagcgcttcacccacctgcgcctcaagcagcacccagacggcggcatcgcc
cgcctgcgggtgtacggcgaggtcgtcgcggaccccgcctggctcgccgccctcggtacc
ttcgacgtggtggccctggagaacggcggccaggtcgaggacgcctccaacctcttctac
tccccggccaccaacaccatccagccgggccgctcccgcaagatggacgacggctgggag
acccgccgccgccgcgacaagggcaacgactggatccagtaccgcctggtggaccgctcg
cagatccgcgcgatcgagatcgacacggcgtacctgaagggcaacagcgccggctgggcc
tccgtctccgtcaaggacggcgaggcgggcgagtggcgcgaggtgctcccgcgcacccgg
atgcagcccgacaccaaccaccgcttcgtcctgccggaggcggccgtcggcacccacgcg
cgcgtggacatcttccccgacggcggcatctcccggctgcgcctgttcggctccctgacc
gaggacggcgcggcccgcctcgccgcccgccaccaggaactgggcggctga

DBGET integrated database retrieval system