KEGG   Streptomyces coelicolor: SCO6260Help
Entry
SCO6260           CDS       T00085                                 

Gene name
SCAH10.25
Definition
(RefSeq) sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sco  Streptomyces coelicolor
Pathway
sco00010  Glycolysis / Gluconeogenesis
sco00052  Galactose metabolism
sco00500  Starch and sucrose metabolism
sco00520  Amino sugar and nucleotide sugar metabolism
sco00521  Streptomycin biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
Module
sco_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO6260 (SCAH10.25)
   00052 Galactose metabolism
    SCO6260 (SCAH10.25)
   00500 Starch and sucrose metabolism
    SCO6260 (SCAH10.25)
   00520 Amino sugar and nucleotide sugar metabolism
    SCO6260 (SCAH10.25)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SCO6260 (SCAH10.25)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SCO6260 (SCAH10.25)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SCO6260 (SCAH10.25)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG FGGY_N DEDD_Tnp_IS110
Motif
Other DBs
NCBI-GeneID: 1101701
NCBI-ProteinID: NP_630360
Kitasato: SCO6260
UniProt: Q9RKT2
Position
6882242..6883390
Genome map
AA seq 382 aa AA seqDB search
MSTYRDFTAPIGSRRAPVLRTVGTRERRSHLTAPRVPTVGIDIGGTKVMAGVVDADGNIL
EKLRTETPDKSKSPKVVEDTIVELVLDLSDRHDVHAVGIGAAGWVDADRNRVLFAPHLSW
RNEPLRDRIAGRLAVPVLVDNDANTAAWAEWRFGAGRGEDHLVMITLGTGIGGAILEDGQ
VKRGKYGVAGEFGHMQVVPGGHRCPCGNRGCWEQYSSGNALVREARELAAADSPVAYGII
EHVKGSIGDITGPMITELAREGDAMCVELLQDIGQWLGVGIANLAAALDPSCFVIGGGVS
AADDLLIGPARDAFKRQLTGRGYRPEARIVRAQLGPEAGMVGAADLSRLVARRFRRAKRR
RVERYERYERYAEARRESRESL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagcacctaccgcgacttcaccgcccccatcggctcccgccgcgccccggtcctgcgc
accgtgggcacgagggaacgccgctcgcacctcacggcaccccgcgtgcccacggtcggc
atcgacatcggcggcacgaaggtcatggcgggtgtcgtcgacgccgacggcaacatcctg
gagaagctccgcacggagaccccggacaagtccaagagcccgaaggtcgtcgaggacacg
atcgtcgaactggtcctggacctctccgaccggcacgacgtgcacgccgtcggcatcggc
gcggccggctgggtcgacgccgaccgcaaccgcgtcctgttcgccccccacctgtcctgg
cgcaacgaaccgctgcgcgaccgcatcgccggccgcctcgccgtgcccgtcctggtggac
aacgacgccaacaccgccgcctgggccgagtggcgcttcggcgcgggccgcggcgaggac
cacctcgtcatgatcacgctcggcaccggcatcggcggcgcgatcctcgaggacggccag
gtcaagcggggcaagtacggcgtcgccggcgagttcgggcacatgcaggtcgtccccggc
ggccatcgctgcccgtgcggcaaccgcggctgctgggagcagtacagctccgggaacgcc
ctggtcagggaggcccgggagctggccgccgccgactccccggtggcgtacgggatcatc
gagcacgtcaagggcagcatcggcgacatcaccggcccgatgatcaccgagctggcccgc
gagggcgacgccatgtgcgtcgagctgctccaggacatcggacagtggctcggcgtcggc
atcgcgaacctcgccgcggccctcgacccgtcctgcttcgtgatcggcggcggggtcagc
gccgccgacgacctgctgatcggccccgcgcgcgacgccttcaagcgccagctcaccggc
cgcggctaccgccccgaggcccgcatcgtccgcgcccagctcggccccgaggccggcatg
gtgggcgccgccgacctgtcccggctggtcgcccgccgtttccgtcgggccaagcggcgc
cgggtggagcggtacgagcgctacgagcggtacgccgaggcccgccgtgagtcccgggag
tcgctgtga

DBGET integrated database retrieval system