KEGG   Streptomyces coelicolor: SCO6270Help
Entry
SCO6270           CDS       T00085                                 

Gene name
SCAH10.35c
Definition
(RefSeq) oxidoreductase alpha-subunit
  KO
K00174  2-oxoglutarate/2-oxoacid ferredoxin oxidoreductase subunit alpha [EC:1.2.7.3 1.2.7.11]
Organism
sco  Streptomyces coelicolor
Pathway
sco00010  Glycolysis / Gluconeogenesis
sco00020  Citrate cycle (TCA cycle)
sco00620  Pyruvate metabolism
sco00650  Butanoate metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
Module
sco_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sco_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO6270 (SCAH10.35c)
   00020 Citrate cycle (TCA cycle)
    SCO6270 (SCAH10.35c)
   00620 Pyruvate metabolism
    SCO6270 (SCAH10.35c)
   00650 Butanoate metabolism
    SCO6270 (SCAH10.35c)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.3  2-oxoglutarate synthase
     SCO6270 (SCAH10.35c)
    1.2.7.11  2-oxoacid oxidoreductase (ferredoxin)
     SCO6270 (SCAH10.35c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N POR PFOR_II TPP_enzyme_N
Motif
Other DBs
NCBI-GeneID: 1101711
NCBI-ProteinID: NP_630370
Kitasato: SCO6270
UniProt: Q9RKS4
Position
complement(6895193..6897085)
Genome map
AA seq 630 aa AA seqDB search
MTTADTMPVGDETVKDVRRLDRVIIRFAGDSGDGMQLTGDRFTSETASFGNDLSTLPNFP
AEIRAPAGTLPGVSSFQLHFADHDILTPGDAPNVLVAMNPAALKANVDDLPRGAEIIVNT
DEFTRRAMQKVGYDTSPLEDGSLDGYHLHPVPLTTLTVQALGEFDLSRKEAERSKNMFAL
GLLSWMYHRPTEGTEKFLRSKFAKKPEIAAANIAAYRAGWNFGETTEDFAVSYEVAPAAT
AFPPGTYRNISGNLALAYGLIAASRRADLPLFLGSYPITPASDILHELSKHKNFGVRTFQ
AEDEIAGIGAALGAAFGGALAVTTTSGPGVALKSETIGLAVSLELPLLVVDIQRGGPSTG
LPTKTEQADLLQAMFGRNGEAPVAVLAPQTAADCFDAALEAARIALAYRTPVFLLSDGYL
ANGSEPWRIPEPDELPDLTVQFAQGPNHTLDDGSEVFWPYKRDPHTLARPWAVPGTPGLE
HRIGGIEKQDGTGNISYDPANHDFMVRTRQAKIDGITVPDLAVDDPDGARTLVLGWGSTY
GPITAAVRRIRKEVGQIAQAHLRHLNPFPANLGAVLERYDKVVVPEMNLGQLATLIRAKY
LVDAQSYNQVNGMPFKAEQLATVLKEAIDA
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgcagacacgatgcccgtcggcgacgagaccgtgaaggatgtccgtcggctg
gaccgggtgatcatcaggttcgcgggggactccggcgacgggatgcagctcaccggtgac
cgtttcacctcggaaacggcgtcgttcggcaatgatctgtcgacgctgccgaacttcccg
gccgagatccgggcacccgccggcaccctgccgggcgtctcgtcgttccagctgcacttc
gccgaccacgacatcctcacgccgggcgacgcgcccaacgtgctggtggcgatgaacccg
gccgcgttgaaggcgaacgtggacgacctgccgcgcggcgcggagatcatcgtcaacacg
gacgagttcaccaggcgggcgatgcagaaggtcggctacgacacctctccgctggaggac
ggctccctggacggctaccacctgcatccggtgccgctgaccacgctgaccgtccaggcg
ctgggcgagttcgacctcagccgcaaggaggccgagcgcagcaagaacatgttcgcgctc
gggttgctgtcgtggatgtatcaccggcccaccgagggcacggagaagttcctgaggtcg
aagttcgcgaagaagccggagatcgccgcggcgaacatcgcggcctaccgtgcgggctgg
aacttcggtgagaccacggaggatttcgcggtctcctacgaggtggcgccggcggcgacg
gcgttcccgcccggcacctaccgcaacatctccgggaacctggccctggcctacggtctg
atcgccgcgtcccggcgcgcggacctgccgctgtttttgggctcctatcccatcactccg
gcgtccgacatcctgcacgagctgtcgaagcacaagaacttcggggtgcgtaccttccag
gcggaggacgagatcgcggggatcggggcggcgctgggggcggccttcggcggtgcgctg
gcggtgaccacgacgtccggtccgggggtggcgctcaagtcggagacgatcgggctggcg
gtgtcgttggagttgccgctgctggtggtggacatccagcggggcggcccgtcgacgggt
ctgccgaccaagacggagcaggccgacctgctgcaggcgatgttcgggcgcaacggcgag
gcaccggttgcggtcctcgccccgcagactgcggccgactgcttcgacgccgccctggag
gcggcgcggatcgcgctggcctaccggactccggtcttcctgctctccgacggctatctc
gccaacggctccgaaccgtggcggatccccgagccggacgaactgccggatctgaccgtg
cagttcgcgcagggccccaaccacaccctggacgacggcagtgaggtgttctggccctac
aagcgcgacccgcacaccctggcccgcccctgggcggtaccgggcacccccgggctcgag
caccggatcggcggcatcgagaagcaggacggcaccgggaacatctcctacgacccggcc
aaccacgacttcatggtccgcacccgccaggccaagatcgacggcatcaccgtccccgac
ctggccgtcgacgacccggacggcgcacggaccctcgtgctgggctggggctccacctac
gggccgatcaccgccgccgtgcgccggatccgcaaggaggtcggccagatcgcccaggcc
cacctgcgccacctcaaccccttcccggccaacctcggcgcggtcctcgagcggtacgac
aaggtggtggtcccggagatgaacctcggtcagctcgccaccctgatccgggcgaaatac
ctggtcgacgcccagtcgtacaaccaggtcaacggcatgccgttcaaggcggaacagctc
gccacggtcctgaaggaggccatcgatgcctga

DBGET integrated database retrieval system