KEGG   Streptomyces coelicolor: SCO6297Help
Entry
SCO6297           CDS       T00085                                 

Gene name
SCBAC8D1.10c
Definition
(RefSeq) 3-hydroxyacyl-CoA dehydrogenase
  KO
K17735  carnitine 3-dehydrogenase [EC:1.1.1.108]
Organism
sco  Streptomyces coelicolor
Brite
KEGG Orthology (KO) [BR:sco00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SCO6297 (SCBAC8D1.10c)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.108  carnitine 3-dehydrogenase
     SCO6297 (SCBAC8D1.10c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH NAD_binding_2 Epimerase
Motif
Other DBs
NCBI-GeneID: 1101738
NCBI-ProteinID: NP_630395
Kitasato: SCO6297
UniProt: Q93RX5
Position
complement(6957019..6957975)
Genome map
AA seq 318 aa AA seqDB search
MTSPENVRRVACVGAGVIGGGWVAHFLARGYEVTAWDPAPDAEPRLRRLVEAAWPTLTRL
GLAEGASTDRLTVTDTLEQAVADAEFVQESAPEKLDLKRDLLARLDAATPPGVVIASSTS
GYPMTDMQTTAADPSRLVVGHPFNPPYLIPLVEVVGGERTAAAAVAWASRFYEVAGKSVI
TMDNEVPGFIANRLQEALWREALHMVASGEATVRDIDLSITEGPGLRWAVMGPMLTFALA
GGEGGMAHMLDHFGPSLKSPWTRLAAPELDKELYDAVVAGCDEAADGRSIADLVAERDRG
VVEVLRATGRLGPEEDSR
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgcccgagaacgtccgccgcgtcgcctgtgtcggcgccggagtcatcggcggc
ggctgggtggcccacttcctggcgcgcggctacgaggtgaccgcctgggacccggcgccc
gacgccgaaccgaggctgcgccgcctggtcgaggcggcgtggccgacgctcacccggctc
ggcctcgccgagggcgcgtcgacggaccggctcaccgtcaccgacaccctggaacaagcc
gtcgcggacgccgagttcgtccaggagagcgcgcccgagaagctcgacctcaagcgcgat
ctgctggcccgcctggacgcggcgacaccacccggcgtggtcatcgcctcgtccacctcc
ggctatccgatgaccgacatgcagacgacggccgcggacccctcgcgcctggtcgtcggc
cacccgttcaacccgccctatctcatcccgctcgtcgaggtcgtcggcggcgagcgcacc
gccgcggcggcggtggcctgggcctcccgcttctacgaggtcgcgggcaagtccgtcatc
acgatggacaacgaggtgccgggcttcatcgcgaaccgcctccaggaggcgctgtggcgg
gaggcgctgcacatggtcgcgagcggcgaggcgacggtccgggacatcgacctgtcgatc
accgagggacccgggctgcgctgggcggtgatggggccgatgctgacgttcgcgctcgcg
ggcggcgagggcggcatggcgcacatgctggaccacttcggcccgtccctgaagtcgccg
tggacgcgcctggcggcgccggaactggacaaggagttgtacgacgcggtggtggccggc
tgcgacgaggcggcggacggccgctccatcgccgacctggtggccgaacgcgaccggggc
gtcgtcgaggtactgcgcgccaccggccgcctgggccccgaggaggactcccgatga

DBGET integrated database retrieval system