KEGG   Streptomyces coelicolor: SCO6457Help
Entry
SCO6457           CDS       T00085                                 

Gene name
SC9B5.24
Definition
(RefSeq) beta-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
sco  Streptomyces coelicolor
Pathway
sco00052  Galactose metabolism
sco00511  Other glycan degradation
sco00600  Sphingolipid metabolism
sco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SCO6457 (SC9B5.24)
  Lipid metabolism
   00600 Sphingolipid metabolism
    SCO6457 (SC9B5.24)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SCO6457 (SC9B5.24)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SCO6457 (SC9B5.24)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C Bgal_small_N Glyco_hydro_2_N DUF4981 Laminin_G_3 Glyco_hydro_2 Bac_rhamnosid_N Glyco_hydro_42
Motif
Other DBs
NCBI-GeneID: 1101896
NCBI-ProteinID: NP_630542
Kitasato: SCO6457
UniProt: Q9ZBF6
Position
7142206..7146129
Genome map
AA seq 1307 aa AA seqDB search
MPHSPVSPAESPAPQPGRPRPVVSRRRLLEGGAAVLGALALSASPLTAQAAVRRAAADEP
PEWNDFGVFRLGTQPPHATLTPYADVEQALAGDRARSPYRLSLDGTWKFAYADRPEDRDA
DFHRTDVDDGDWGTIPVPSVWQLHGHDFPIYLNITYPYWGPNGQGEEPQPPAAPTRYNPV
GQYRRTFTVPRDWRGRRTFLHFEGVKSAHYVWINGELAGYDEDSYTPSEYDVTDLLKPGT
NQIAVEVYRYSDGDWMEDQDMIRLSGIFRSVHLYSTPAVHLRDFKLDTPLDDTYTGAELA
VTASVRAYGEGGTGRYTVETQLYDARGHAVWSRPLQQPVDVGGARAGEDVTVRAAKAVPK
PRLWSAEHPDLYTAVLRLRDPAGKVTETLSHRVGFREFALKDGLMRINGEPVSIRGTNRH
EMHPARGTALTREDMVEDIKIIKRMNMNSVRTSHYPNNPYWLELADEYGLYLVDETNLET
HGIRGEYPGDHPDWTAACVARAQNMVHRDKNHASVVIWSLGNEAGGGSTFSAMHDWIRSY
DDTRVIQYEGDDRPGVSDIRSEMYDSPQRVEQRAKDTSDTRPYVMIEYAHSMGNSTGNFK
KYWDVVRRYDVLQGGWIWDFVDQSLYTPVPARTLLTEAGPAGLRGEILATRGTLDRDEGL
SGITVFERHDSLDLTGSLTLEAWVTPHVTGYHQPIIAKGDTQYALKQNGRTLEFFIHSEG
QWITANWTVPEDWTGREHHLAGVFDADAGTLTLYVDGVERATRTTDRRPSSNTAPLALAS
DADNQVREFSGTVRRARVYARALGAAELASESRGPGDDGVRFWFDAATVKTSTRRPRDKT
FLAYGGDWGDNPNDGAFVADGIVTADRGHTGKAAEVKRVYQAIDAARTPGGGPGAVTLTN
EYLFTRLREFDGHWELVADGEVVRRGRLTRDQLDVAPRSSKDITVPVRLPGRPGPGTEYF
LQLSFTTKESTPWAKAGFEVARRQLPVAADVPAVTPVRAASVPALRHEDRDREVEVTGRG
FSVTVDKRTGTISSYEAKGTRLITSGPVPNFWRAPTDNDKGNGQHTRNQTWRDAGARRKV
TGVIVRALGDRAVEIKVTGTLPTSVESTYGTTYTVFGNGEIKVDNTLHPGAANLPYIPEV
GTMLFLPRGLDRVHWYGRGPEENHWDRNDGTDVGRYSGTVAEQWTPYIRPQENGNKTDVR
WIALTDRHGVGLLASGEPLLEANASYFTPEDLSAGVRHDYQLTPRDEVVLRLNHRQMGVG
GDNSWGAHTHDEFKLFADRDYAYTYRLRPLTDVRDATRASRRPTATE
NT seq 3924 nt NT seq  +upstreamnt  +downstreamnt
atgccgcactcgcccgtgtcacccgccgaatccccggccccccagcccggccggccccgc
ccggtcgtcagccgccgccgcctcctggagggcggtgccgccgtcctcggcgccctcgcg
ctgtccgcgtcgcccctcacggcacaggcggccgtacggcgggcggcggccgacgagccg
ccggagtggaacgacttcggcgtcttccggctcggcacccagccgccgcacgccacgctc
acgccgtacgcggacgtcgagcaggcgctcgccggcgaccgcgcccgctcgccctaccgg
ctcagcctggacggcacctggaagttcgcctacgccgaccgtcccgaggaccgggacgcc
gacttccaccgcaccgacgtggacgacggggactgggggaccatccccgtcccgtccgtg
tggcagctgcacggccacgacttccccatctacctgaacatcacctacccgtactggggt
cccaacggccagggcgaggagccgcagccgcccgccgcgccgacccgctacaacccggtc
ggccagtaccggcgcaccttcaccgtcccccgggactggaggggccgtcgcaccttcctc
cacttcgagggcgtcaagtccgcgcactacgtctggatcaacggcgaactggccggctac
gacgaggactcctacacgccctccgagtacgacgtcaccgacctcctcaagccgggcacc
aaccagatcgccgtcgaggtctaccgctactccgacggcgactggatggaggaccaggac
atgatccggctgagcggcatcttccgctcggtccacctctactccaccccggccgtgcac
ctgcgcgacttcaagctggacaccccgctcgacgacacctacaccggcgccgaactggcc
gtcaccgcgagcgtgcgggcgtacggcgagggcggcacgggccgctacaccgtcgagacc
cagctgtacgacgcgcgcggccacgccgtctggtcccggccgctgcaacagcccgtcgac
gtcggcggggcccgcgcgggcgaggacgtcacggtgcgggccgcgaaggcggtgccgaag
ccccggctctggtccgccgaacaccccgacctctacacggccgtcctgcgcttgcgcgat
cccgccgggaaggtgaccgagaccctgtcgcaccgggtcggcttccgcgagttcgcgctc
aaggacgggctgatgcggatcaacggcgagccggtgtccatccgcggcaccaaccgccac
gagatgcaccccgcccgcggcaccgcgctcacccgcgaggacatggtcgaggacatcaaa
atcatcaagcggatgaacatgaacagcgtccgcacctcgcactaccccaacaacccctac
tggctcgaactggccgacgagtacggcctctacctcgtcgacgagaccaacctggagacg
cacggcatccgcggcgagtaccccggcgaccacccggactggaccgccgcctgcgtggcc
cgcgcccagaacatggtgcaccgcgacaagaaccacgcctcggtcgtcatctggtcgctg
ggcaacgaggcgggcggcggctccaccttcagcgccatgcacgactggatccgctcctac
gacgacacccgcgtcatccagtacgagggcgacgaccgccccggcgtcagcgacatccgc
tcggagatgtacgacagcccgcagcgcgtcgagcagcgcgcgaaggacacctccgacacc
cggccgtacgtcatgatcgagtacgcccactcgatggggaactccaccggcaacttcaag
aagtactgggacgtcgtccgccgctacgacgtcctccagggcggctggatctgggacttc
gtcgaccagtccctctacacgcccgtccccgcccgcaccctgctcaccgaggccgggccc
gccgggctgcgcggggagatcctcgccacccgcggcaccctcgaccgcgacgagggcctg
tccggcatcaccgtcttcgagcgccacgacagcctcgacctcacgggctcactgaccctg
gaggcctgggtcaccccgcacgtgacgggctaccaccagccgatcatcgccaagggcgac
acccagtacgcgctgaagcagaacggccggaccctggagttcttcatccactccgaaggc
cagtggatcaccgcgaactggaccgtgccggaggactggaccggccgcgagcaccacctc
gcgggcgtcttcgacgcggacgccgggaccctgaccctctacgtcgacggcgtcgaacgg
gccacccgcaccaccgaccggcgccccagcagcaacaccgcgcccctcgcgctcgcctcc
gacgccgacaaccaggtgcgggagttcagcggcaccgtccgccgcgcccgcgtctacgcc
cgcgccctcggcgccgccgaactggcctccgagagccgcggacccggcgacgacggtgtg
cggttctggttcgacgccgccacggtgaagacctcgacgcggcgcccccgggacaagacg
ttcctcgcctacggcggcgactggggcgacaaccccaacgacggcgccttcgtcgcggac
ggcatcgtcaccgccgaccgcggccacaccggcaaggccgccgaggtcaagcgcgtctac
caggcgatcgacgccgcccgcaccccgggcggcggccccggcgccgtcaccctcaccaac
gagtacctcttcacccgcctccgcgagttcgacgggcactgggaactcgtcgccgacggc
gaggtcgtacggcgcgggaggctgacccgggaccaactggacgtggcaccgcgctccagc
aaggacatcaccgtccccgtccggctgccggggcgacccggcccgggtaccgagtacttc
ctccagctctccttcaccaccaaggagtccaccccgtgggcgaaggcgggcttcgaggtg
gcccgccggcagctccccgtcgcggccgacgtcccggcggtgaccccggtccgcgcggcg
agcgtgccggccctgcgccacgaggaccgcgaccgggaggtcgaggtcaccggcaggggc
ttctcggtcaccgtcgacaagcgcaccggcaccatcagctcctacgaggccaagggcacc
cggctgatcacctcgggaccggtgcccaacttctggcgcgcgcccaccgacaacgacaag
ggcaacggccagcacacccgcaaccagacctggcgcgacgcgggcgcccgccggaaggtc
accggcgtcatcgtgcgcgcgctcggcgaccgggccgtcgagatcaaggtcaccggcacg
ctgcccacctcggtggagtccacgtacggcaccacctacacggtgttcggcaacggcgag
atcaaggtcgacaacaccctgcacccgggcgccgcgaacctgccctacattcccgaggtc
ggcacgatgctgttcctgccgcgcggcctggaccgcgtgcactggtacggccgcggcccc
gaggagaaccactgggaccgcaacgacggcacggacgtcggccgctactccgggaccgtc
gccgagcagtggacgccgtacatccgcccgcaggagaacggcaacaagaccgacgtccgc
tggatcgccctcaccgaccgccacggcgtgggcctgctcgcctccggcgaacccctcctg
gaggccaacgcgtcgtacttcacgccggaggacctgtcggccggcgtgcggcacgactac
cagctcaccccgagggacgaggtcgtcctgcggctgaaccaccggcagatgggcgtcggc
ggcgacaacagctggggcgcgcacacccacgacgagttcaagctcttcgccgaccgggac
tacgcgtacacctaccggctgcgcccgctcaccgacgtgcgcgacgcgacgcgcgcctcg
cgacggccgacggcgacggaatag

DBGET integrated database retrieval system