KEGG   Streptomyces coelicolor: SCO6466Help
Entry
SCO6466           CDS       T00085                                 

Gene name
SC9C7.02
Definition
(RefSeq) transferase
  KO
K00865  glycerate 2-kinase [EC:2.7.1.165]
Organism
sco  Streptomyces coelicolor
Pathway
sco00260  Glycine, serine and threonine metabolism
sco00561  Glycerolipid metabolism
sco00630  Glyoxylate and dicarboxylate metabolism
sco01100  Metabolic pathways
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SCO6466 (SC9C7.02)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SCO6466 (SC9C7.02)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO6466 (SC9C7.02)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.165  glycerate 2-kinase
     SCO6466 (SC9C7.02)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gly_kinase
Motif
Other DBs
NCBI-GeneID: 1101905
NCBI-ProteinID: NP_630549
Kitasato: SCO6466
UniProt: Q9ZBK8
Position
7154053..7155195
Genome map
AA seq 380 aa AA seqDB search
MDGTRRVLVAADKFKGSLTAVEVAERVTAGLRRVVPDVLVEALPVADGGDGTVAAAVAAG
FERREARVAGPLGEEVTAAYALRGDTAVVEMAEASGLQRLPEGVLAPLTSSTYGSGELLR
AALDAGARTIVFGVGGSATTDGGAGMLAALGARFLDGNGEPVAPGGGGLAGLVSADLSGL
DSRLSDVELVLASDVDNPLTGPKGAPAVYGPQKGASPDDVTALDAALAHFAKVLERTEGV
GARAAEYAASPGAGAAGGIGFGAMLLGARFRPGIEVMLDVLGFAPALERADLVITGEGSL
DEQTLHGKAPAGVAAAARAAGKEVVAVCGRLALPAEVLGRAGIRRAYPLTDVEPDVAKCI
ADAGPILERVAESIARDFLA
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
gtggacgggacccgccgggtactcgtcgccgcggacaagttcaagggctcgctgacggcc
gtcgaggtcgccgagcgcgtcacggccggactgcgccgcgtcgtgccggacgtcctggtc
gaggcgctgcccgtcgccgacggcggcgacggcacggtggccgccgcggtcgcggccgga
ttcgaacgccgggaggcacgggtcgccggtcccctcggcgaggaggtgacggcggcgtac
gcgctgcgcggcgacaccgccgtcgtggagatggccgaggccagcggcctccagcggctc
ccggaaggcgtcctcgcgccgctgacgtcgtccacgtacggctcgggcgagctgctgcgg
gccgcactggacgcgggggcgcggacgatcgtgttcggggtcggcggcagcgccaccacg
gacggcggcgccgggatgctggccgcgctcggggcgcggttcctggacgggaacggcgag
ccggtcgcgccgggcgggggcggtctcgcggggctggtctcggccgacctgtcgggcctc
gactcccgcctgtccgacgtggagctggtgctcgccagcgacgtcgacaatccgctgacc
gggccgaagggcgccccggcggtctacgggccgcagaagggtgcctcgccggacgacgtg
acggccctggacgcggccctcgcgcacttcgcgaaggtcctggagcggacggagggcgtg
ggcgcgcgggccgccgagtacgccgcgtcgccgggcgcgggtgcggcgggcggcatcggg
ttcggcgcgatgctgctgggcgcgcggttccggcccggcatcgaggtgatgctggacgtg
ctgggcttcgcgccggcgctggagcgggcggacctggtgatcaccggggagggctcgctg
gacgagcagaccctgcacgggaaggcgccggcgggtgtcgcggcggcggcacgggccgcg
ggcaaggaggtcgtcgcggtgtgcgggcgcctggcgctgccggcggaggtgctggggcgg
gccgggatccggcgggcgtatccgctgacggacgtcgagccggacgtcgcgaagtgcatc
gcggacgcggggccgatcctggagcgggtggccgagtccatcgcgcgggacttcctggcc
tag

DBGET integrated database retrieval system