KEGG   Streptomyces coelicolor: SCO6472Help
Entry
SCO6472           CDS       T00085                                 

Gene name
SC9C7.08c
Definition
(RefSeq) coenzyme B12-dependent mutase
  KO
K14447  ethylmalonyl-CoA mutase [EC:5.4.99.63]
Organism
sco  Streptomyces coelicolor
Pathway
sco00630  Glyoxylate and dicarboxylate metabolism
sco01120  Microbial metabolism in diverse environments
sco01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SCO6472 (SC9C7.08c)
Enzymes [BR:sco01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.63  ethylmalonyl-CoA mutase
     SCO6472 (SC9C7.08c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MM_CoA_mutase B12-binding
Motif
Other DBs
NCBI-GeneID: 1101911
NCBI-ProteinID: NP_630555
Kitasato: SCO6472
UniProt: Q9ZBK2
Position
complement(7159875..7161902)
Genome map
AA seq 675 aa AA seqDB search
MTERHKDRPWLMRTYAGHSTAEASNELYRRNLAKGQTGLSVAFDLPTQTGYDSDHVLARG
EVGRVGVPVAHLGDMRRLFQDIPLEQMNTSMTINATAMWLLALYQVVAEEQGADLTKLQG
TTQNDIVKEYLSRGTHVFPPGPSLRLTTDMIAYTVSHLPKWNPINICSYHLQEAGATPVQ
EIAYAMSTAIAVLDAVRDSGQVPQERMGDVVGRISFFVNAGVRFVEEMCKMRAFGRIWDR
VTRERYGIENPKHRRFRYGVQVNSLGLTEAQPENNVQRIVLEMLAVTLSKDARARAVQLP
AWNEALGLPRPWDQQWSLRIQQVLAHESDLLEYEDLFEGSKVVEAKVDELVEAAFAEIER
IQEMGGAMAAVESGYLKSQLVASHAERRARIESGEEKIIGVNAFEGTEPNPLTADLDTAI
QTVDPAVEARVIASLQSWRDTRYQPPFNHPRPCKALEKLKEAARGTGNLMEATLECARAG
ATTGEWAGALREVFGEFRAPTGVSSAPVAVTAEEGSALSQVRRKVELTAKEMEVGKLRFL
VGKPGLDGHSNGAEQIAVRARDAGFEVVYQGIRLTPEQIVDAALAEDVHAVGLSILSGSH
AQLVPDVLERLRVAGATDIPVIAGGIIPNGDAEELRAAGVAAVFTPKDFDITGIIGRIVD
EIRYANKLDPLEVPA
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcgtcacaaggaccggccgtggctcatgcgcacctacgccggtcactccacg
gccgaggcgtccaacgagctgtaccggcgcaacctcgccaagggccagacgggtctgtcg
gtcgccttcgacctgccgacccagaccggctacgactccgaccacgtcctcgcccgcggc
gaggtcggccgggtcggcgtgccggtcgcgcacctcggtgacatgcgccggctgttccag
gacatcccgctggagcagatgaacacctcgatgaccatcaacgccacggccatgtggctg
ctggcgctctaccaggtcgtcgcggaggagcagggcgcggacctcaccaagctccagggc
acgacccagaacgacatcgtcaaggagtacctgtcccgggggacgcacgtcttcccgccg
ggaccgtcgctccgcctgacgacggacatgatcgcgtacacggtgtcccacctgcccaag
tggaacccgatcaacatctgcagctaccacctgcaggaggcgggcgccacgccggtgcag
gagatcgcgtacgcgatgtccaccgcgatcgccgtgctcgacgcggtgcgggacagcggt
caggtgccgcaggagcgcatgggtgacgtggtcggccgcatctccttcttcgtgaacgcg
ggcgtccgcttcgtcgaggagatgtgcaagatgcgcgccttcggccgcatctgggaccgc
gtcacccgcgagcgctacggcatcgagaaccccaagcaccgccgcttccgctacggcgtc
caggtcaactccctgggcctgaccgaggcgcagccggagaacaacgtgcagcggatcgtg
ctggagatgctggcggtcaccctctccaaggacgcacgcgcgcgtgccgtgcagttgccg
gcctggaacgaggcgctgggcctgccccggccctgggaccagcagtggtcgctgcgcatc
cagcaggtgctggcgcacgagagcgacctgctggagtacgaggacctcttcgagggctcg
aaggtggtcgaggcgaaggtcgacgagctggtcgaggcggcgttcgcggagatcgaacgc
atccaggagatgggcggcgcgatggccgccgtcgagtccggctacctcaagtcccagctg
gtggcctcgcacgccgagcgccgggcccggatcgagtccggcgaggagaagatcatcggt
gtcaacgccttcgagggcaccgagcccaacccgctgaccgccgacctggacaccgcgatc
cagacggtcgacccggcggtggaggcccgtgtcatcgcctcgctgcagagctggcgggac
acgcggtaccagccgcccttcaaccacccgcgcccctgcaaggcgctggagaagctgaag
gaggcggcacgcggcaccggcaacctcatggaggccaccctggagtgcgcccgcgccggt
gccacgaccggcgagtgggccggggcgctgcgcgaggtcttcggcgagttccgggcgccg
accggcgtgtcctcggcgccggtcgcggtcaccgcggaggagggttcggccctgtctcag
gtgcgccgcaaggtggagctgacggccaaggagatggaggtcggcaagctccgcttcctg
gtcggcaagcccggcctggacggccactccaacggcgccgagcagatcgccgtgcgcgcc
cgcgacgccgggttcgaggtggtctaccagggcatccggctcaccccggagcagatcgtg
gacgccgccctcgcggaggacgtgcacgcggtgggcctgtccatcctgtccggctcgcac
gcccaactggtgccggacgtactcgaacggctccgtgtggccggtgccacagacatcccg
gtgatcgccggtggcatcatcccgaacggtgacgccgaggaactgcgggccgcgggagtg
gccgcggtcttcaccccgaaggacttcgacatcaccggcatcatcggccggatcgtcgac
gagatccggtacgcgaacaagctcgaccccctggaggtccccgcatga

DBGET integrated database retrieval system