KEGG   Streptomyces coelicolor: SCO6561Help
Entry
SCO6561           CDS       T00085                                 

Gene name
SC4B5.11c
Definition
(RefSeq) respiratory chain oxidoreductase
  KO
K00123  formate dehydrogenase major subunit [EC:1.17.1.9]
Organism
sco  Streptomyces coelicolor
Pathway
sco00630  Glyoxylate and dicarboxylate metabolism
sco00680  Methane metabolism
sco01100  Metabolic pathways
sco01120  Microbial metabolism in diverse environments
sco01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SCO6561 (SC4B5.11c)
  09102 Energy metabolism
   00680 Methane metabolism
    SCO6561 (SC4B5.11c)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.9  formate dehydrogenase
     SCO6561 (SC4B5.11c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Molybdopterin Molydop_binding
Motif
Other DBs
NCBI-GeneID: 1102000
NCBI-ProteinID: NP_630642
Kitasato: SCO6561
UniProt: Q9ZBV7
Position
complement(7261448..7263376)
Genome map
AA seq 642 aa AA seqDB search
MRKRDRTPKTYTRLTHPLVRDSREAPLRRATWEEALDRTARGLTAARGAFGMFSCARATN
EMNYVAQKFARVVMGTHNVDSCNRTCHAPSVAGLSAAFGSGGGTSSYEEIEHTDVIVMWG
SNARFAHPIFFQHVLKGIRGGARMYVVDPRRTSTAEWAESWLGPNVGTDIPLAHAVGREI
IHAGLANEAFIERATTGYDDYKALVEPWTLSLAEKVTGVPAAAIRELAHAYARAERAQLC
WTLGITEHHNGTDNVRALINLSLLTGHVGRYGSGLQPLRGQNNVQGGGDMGAIPNRLPGF
QDVLDPEVRRKFETAWDTVVEPHHGLTLTEMFEAMDEGTLRAVYCIGENPAQSEADAEQA
VRRLRALDFLVVQDIFLTKTAELADVVLPATAGWAETEGTTTNSERRVQRVRRAVSPPGE
AREDIDILCDLAARLGHDWKYADAEAVWNELRSLSPDHHGMTYARLEEHQGIQWPCPSTQ
ELEPTYLHGRLWAQDPASRGRLAPFGIVRHDPPVDLTDEQYPIRLTTGRRLDSYNTGVQS
GGYASPLRRGESVELCPEDAERYGVVVGEEVRVTSRRGSLLAPVWVDTALRPGLAFMSFH
FPDEVDTNQLTIEANCPIAGTAEFKASAIRIEKVSASGPALR
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaacgcgaccgaacccccaagacctacacccgcctcacccaccccctggtccgg
gactcgcgcgaggcgcccttgcgccgggcgacctgggaggaggcactggaccgcacggcc
cggggcctgacggcggcgcgcggcgcgttcgggatgttctcctgcgcgcgggcgaccaac
gagatgaactacgtggcccagaagttcgcccgggtggtcatgggcacccacaacgtggac
tcctgcaaccgcacctgtcacgcaccgagcgtggcgggcctgtcggccgccttcggctcg
ggcggcggcacctcctcctacgaggagatcgagcacaccgacgtcatcgtgatgtggggc
tccaacgcccgtttcgcgcacccgatcttcttccagcacgtgctgaagggcatacggggc
ggcgcccgcatgtacgtggtggacccgcgccgcacctcgaccgccgagtgggcggagagc
tggctcggaccgaacgtcggcacggacatcccgctggcacacgcggtcggccgggagatc
atccacgcgggcctggccaacgaggcgttcattgaacgcgcgacgacgggctacgacgac
tacaaggccctggtcgaaccctggaccctctccctcgccgagaaggtgaccggcgtaccg
gccgccgccatccgcgagctggcgcacgcctacgcccgtgccgagcgcgcccagctgtgc
tggaccctcggcatcaccgagcaccacaacggcaccgacaacgtccgcgccctgatcaac
ctctccctgctcaccggccacgtcggccgctacggctccggtctgcaacccctgcgcggc
cagaacaacgtgcagggcggcggcgacatgggcgccatccccaatcgcctccccggcttc
caggacgtcctggacccggaggtccgccggaagttcgagacggcgtgggacacggtggtc
gagccgcaccacggcctcacgctgacggagatgttcgaggcgatggacgagggcacgctc
cgcgccgtctactgcatcggcgagaacccggcccagtcggaggcggacgccgaacaggcg
gtacgccgcctgcgcgccctggacttcctggtggtccaggacatcttcctcaccaagacc
gccgaactggcggacgtggtcctcccggccacggcgggctgggcggagacggagggcacc
accaccaacagcgaacgacgcgtgcaacgcgtccgcagggccgtgtccccgcccggcgag
gcccgggaggacatcgacatcctctgcgacctcgccgcccgcctgggccacgactggaag
tacgccgacgccgaggcggtctggaacgagctgcgttccctctcccccgaccaccacggc
atgacctacgcccgcctggaggagcaccagggcatccagtggccgtgcccgagcacgcag
gagctggaaccgacgtatctgcacggcaggttgtgggcccaggacccggcctcccgtggc
cgtctcgcccccttcggtatcgtccggcacgacccgccggtggacctcaccgacgagcag
tacccgatccggctgaccacgggacgccgcctcgactcctacaacacgggggtgcagagc
ggcggttacgcctccccgctgcgccgcggcgagtccgtcgaactctgcccggaggacgcc
gaacgctacggggtcgtggtcggcgaggaggtccgggtcacctcccggcgcggttcgctg
ctcgcacccgtctgggtggacacggccctgcgccccgggctggccttcatgagcttccac
tttcccgacgaggtggacaccaaccagctgaccatcgaggcgaactgtcccatcgccggg
acggcggagttcaaggcctcggcgatccggatcgagaaggtgagcgccagtggacctgcg
cttcggtga

DBGET integrated database retrieval system