KEGG   Streptomyces coelicolor: SCO6562Help
Entry
SCO6562           CDS       T00085                                 

Gene name
SC4B5.12c
Definition
(RefSeq) 2-dehydropantoate 2-reductase
  KO
K00077  2-dehydropantoate 2-reductase [EC:1.1.1.169]
Organism
sco  Streptomyces coelicolor
Pathway
sco00770  Pantothenate and CoA biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
Module
sco_M00119  Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SCO6562 (SC4B5.12c)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.169  2-dehydropantoate 2-reductase
     SCO6562 (SC4B5.12c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ApbA_C ApbA Pyr_redox Pyr_redox_2 NAD_binding_8 3HCDH_N NAD_Gly3P_dh_N F420_oxidored FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 1102001
NCBI-ProteinID: NP_630643
Kitasato: SCO6562
UniProt: Q9ZBV6
Position
complement(7263373..7264344)
Genome map
AA seq 323 aa AA seqDB search
MKVAVLGAGAIGAYVGAALHRAGADVHLIARGPHLAAMRQYGVRVRSPRGDFTAHPRATD
DPAEVGPVDYVFLGLKANSYAACGPLIEPLLHRTTAVVAAQNGIPWWYFHRHGGPYDGRR
LESVDPAGAVSAVLAPERAVGCVVYAATELEQPGVVRHVEGTRFSIGEPGREVSPRCLAL
SEAMQSGGLKCPVEPDLRNDIWLKLLGNISFNPISALVRATMRQMCRHGGTREVIETMMT
ETLAVAAALGCEIGVSIERRLAGAERVGDHRTSTLQDLERGKPLELDVLLAAVVELAEIT
GVPVPTLRTVHALSDLLALRSAA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcgcagtcctcggcgccggggcgatcggcgcctacgtcggcgccgcgctccac
cgtgcgggcgccgacgtgcatctcatcgcccgtggaccgcatctggcggccatgaggcag
tacggagtacgggtgcgcagcccgcgcggcgacttcaccgcgcacccgcgcgccaccgac
gacccggccgaagtcggcccggtcgactatgtgttcctgggtctgaaggccaactcgtac
gcggcgtgcgggccgctgatcgagccgctgctgcaccggaccacggcggtcgtggccgcc
cagaacggcatcccctggtggtacttccaccggcacggcggcccgtacgacgggcgccgt
ctcgagagcgtcgacccggccggcgcggtcagtgcggtgctcgcgcccgaacgggccgtc
ggctgcgtcgtgtacgcggccaccgaactggaacagccgggcgtcgtacgccatgtggaa
ggcacccggttctcgatcggcgagcccggccgggaggtctcgccgcgatgtctggcgctc
agcgaggcgatgcagtcgggcggcctgaagtgcccggtcgagccggacctgcgcaacgac
atctggctgaagctgctgggcaacatctccttcaacccgatcagcgccctggtccgggcc
accatgcggcagatgtgccggcacggcggcacccgcgaggtcatcgaaaccatgatgacc
gagacgctggcggtcgccgcggccctcggctgcgagatcggcgtctccatcgaacgccgg
ctcgcgggcgccgagcgggtcggcgaccaccgcacctccacgctccaggacctggagcgc
ggcaagccgctcgaactcgacgtcctgctcgcggccgtcgtcgaactggcggagatcacc
ggggtcccggtgcccaccctgcgcaccgtgcacgccctgtccgacctgctcgcgctgagg
agcgccgcatga

DBGET integrated database retrieval system