KEGG   Streptomyces coelicolor: SCO6586Help
Entry
SCO6586           CDS       T00085                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit alpha
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
sco  Streptomyces coelicolor
Pathway
sco00020  Citrate cycle (TCA cycle)
sco00640  Propanoate metabolism
sco00660  C5-Branched dibasic acid metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
Module
sco_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sco_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCO6586
   00640 Propanoate metabolism
    SCO6586
   00660 C5-Branched dibasic acid metabolism
    SCO6586
Enzymes [BR:sco01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SCO6586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Succ_CoA_lig Ligase_CoA CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 1102025
NCBI-ProteinID: NP_630665
Kitasato: SCO6586
UniProt: O87841
Position
7296507..7297433
Genome map
AA seq 308 aa AA seqDB search
MAIYLTKESKVLVQGMTGAEGMKHTRRMLAAGTDVVGGVNPRKAGRTVDFDNRTVPVFGS
VREGIERTGADVTVVFVPPAFAEAAVVEAADAGVGLAVVITEGIPVHDSVALTAHARAKG
TRVIGPNCPGLITPGQSNAGIIPPDITKPGRIGLVSKSGTLTYQLMYELRDIGFSTCVGI
GGDPVVGTSHIDCLAAFEDDPDTELIVLIGEIGGDAEERAAAHIRAHVTKPVVAYIAGFT
APEGRTMGHAGAIVSGSSGTARAKKEALESVGVRVGSTPTETARHVLQALDVPGGAAPDG
AARDGARA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggcgatctacctcaccaaggagagcaaggtcctcgtccagggcatgaccggtgccgag
ggcatgaagcacacccgccgcatgctggccgcgggcaccgacgtcgtcggcggcgtcaac
ccgcgcaaggcgggccgcaccgtggacttcgacaaccgcaccgtcccggtcttcggatcg
gtccgcgagggcatcgaacgcacgggcgccgacgtcacggtcgtcttcgtgccaccggcc
ttcgccgaggccgcggtcgtcgaggccgccgacgccggggtcggcctcgcggtcgtcatc
accgagggcatcccggtccacgactccgtcgccctcaccgcccacgcaagggccaagggc
acccgcgtcatcggccccaactgccccggcctgatcacccccggccagtccaacgcgggc
atcatcccgcccgacatcaccaagcccggccgcatcggcctggtctccaagtcgggcacg
ctcacctaccaactcatgtacgaactgcgcgacatcggcttctccacctgcgtcggcatc
ggcggcgacccggtcgtcggcaccagccacatcgactgcctcgccgccttcgaggacgat
cccgacaccgaactgatcgttctcatcggtgagatcggcggcgacgcggaggaacgcgcg
gcggcccacatccgcgcgcacgtcaccaagcccgtcgtcgcctacatcgccggcttcacc
gcgcccgagggccggacgatgggccacgccggtgccatcgtctccggctcctcgggcacg
gcgcgggcgaagaaggaggcgctggagtcggtcggcgtacgggtcgggagcacaccgacc
gagacggcacggcacgtactccaggcactcgacgtacccggaggtgccgcaccggacggc
gcggcccgcgacggagcccgcgcatga

DBGET integrated database retrieval system