KEGG   Streptomyces coelicolor: SCO6640Help
Entry
SCO6640           CDS       T00085                                 

Gene name
SC4G2.14
Definition
(RefSeq) ATP-dependent helicase
  KO
K03724  ATP-dependent helicase Lhr and Lhr-like helicase [EC:3.6.4.-]
Organism
sco  Streptomyces coelicolor
Brite
KEGG Orthology (KO) [BR:sco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sco03400]
    SCO6640 (SC4G2.14)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     SCO6640 (SC4G2.14)
DNA repair and recombination proteins [BR:sco03400]
 Prokaryotic Type
  Other factors with a suspected DNA repair function
   DNA helicases
    SCO6640 (SC4G2.14)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DEAD Helicase_C ResIII SNF2_N DNA_pol3_chi
Motif
Other DBs
NCBI-GeneID: 1102079
NCBI-ProteinID: NP_630716
Kitasato: SCO6640
UniProt: O86686
Position
7374208..7376403
Genome map
AA seq 731 aa AA seqDB search
MADADSSPETEGADVLDRLDPVVLHHIVNTLGWSDLRPLQRAAITPLMEGEDAVLLAPTA
GGKTEAACFPLLSAMAEQKWTGTSVLYLCPLKALLNNLVSRVDTYTQWLGRRAALWHGDT
KESQRQRIRTEAPDVLLTTPESLEAMLIGVKTDHARLLGSVRAVVVDEVHAFAGDDRGWH
LLAVLERLEQVTGRPIQRIGLSATVGNPDQLLDWLQGAGVETRAGRVVAPGVTLPAFEAV
GSDRKPTAEEVPRPAGEVELDYVGSLDNAAKLIATLHRGEKRLVFCDSRAQVEQLGAALR
AREVTVFLSHASLSVDERTRSEQAFAEARDCVIVSTSTLELGIDVGDLDRVIQIDSPATV
ASFLQRIGRTGRRAGTVRNCLFLTTRKDTLLQAAGLLLLWSRGWVEPVKPPPEPRHLVAQ
QLLAVTLQQHKLGDQLWDRQWNGLAPFDQSAAPILRHLTEEGFLDSDGGLLFVGPEAERR
FGKRHFIELTASFTAPPQFTVLSGRTEIGRTDPSVLTEERPGPRRLLLGGRSWQVTYIDW
LRKRVFVEPADSGGIAKWMNGGIAGLTYALTRAMREVMLGEDPPVVLTRRAQARLAEQRE
SDAPDTVHPDGTLVTRAGNDVRWWTWAGYRANATLAATLQSVTDPLQRPTDCWLRLREDL
DPADWHAARKSVGESLVLPDVDPRAVRGLKFSAALPERLAIATVAARLADFDSAWFVLSE
AVRFVVSSDRA
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atggcggatgccgacagctcgcccgagacggaaggggccgacgtactcgacaggctcgac
cccgtcgtcctgcaccacatcgtcaacaccctcggctggtccgatcttcgcccgctccaa
cgagcggcgatcaccccgctcatggagggcgaggacgccgtactgctggcaccgacggcg
ggcggcaagactgaggcggcctgcttccccctgctgtcggccatggcagaacagaagtgg
accggcacctcggtgctctacctctgcccgctcaaagcacttctcaacaacctcgtcagc
cgcgtcgacacgtacacccagtggctgggacgacgtgccgccctctggcacggcgacacc
aaggagtcgcagcggcagcgcattcgaaccgaggcccccgatgtcctgctgaccacgccc
gagtcgctcgaggcgatgctgatcggcgtcaagaccgaccacgcacgcctgctggggagc
gtaagggccgtggttgtcgatgaagtgcacgcttttgccggcgacgaccggggctggcac
ctgttggccgtactggaacggctcgaacaagtcaccgggcggcccatccagcgcatcggt
ctgtccgcgaccgtcggcaatccggatcagttgctggactggctgcagggcgcgggcgtg
gagacccgcgcagggcgcgtcgtcgctccaggggtgacgctgccggcgttcgaggcggtg
ggcagcgatcggaagcccaccgccgaagaggttccccgtccggcgggcgaggtcgaactg
gactacgttgggtccctcgacaacgcggcgaaactcatcgcaaccctgcatcgcggcgaa
aagcgtcttgtcttctgcgactcccgagcccaggtcgaacaactgggtgccgcactgcgc
gcccgcgaggtgacggtcttcctgtcccacgcctccctctccgtcgacgaacgtacccgc
tccgagcaagccttcgccgaggcccgcgactgcgtcatcgtttccacctccactctggaa
ctcggcatcgacgtcggcgacctggaccgcgtcatccaaatcgactcaccggccaccgtc
gcctcgttcctgcaacgcatcggacgcaccggccgacgtgcgggtacggtgcgcaactgc
ctgttcctcaccacacgcaaggacacgctgttgcaggcggccgggctgttgctgctctgg
tcgcgcggctgggtcgaaccggtcaaaccacctccggagccacgtcatctggtggcccag
cagctcctcgccgtcaccctgcagcagcacaagctgggcgaccagttgtgggaccggcag
tggaacggcctggcccccttcgaccagtccgcagctcccatcctgcggcacctgaccgaa
gagggctttctggacagcgacggcggtctgctgttcgtcggtcccgaggctgagcgacgc
ttcggaaagcggcacttcatcgaactcaccgcttccttcaccgcaccaccgcagttcacc
gtgctctccggccgaaccgaaatcggacggaccgacccgagtgtgctcaccgaagaacga
cccggcccgcgccgattgctgctcggcggacgcagttggcaggtcacgtacatcgactgg
ctgcgcaaacgcgtcttcgtcgaacccgccgacagcgggggtatcgccaagtggatgaac
ggaggcatcgccggactcacgtacgccctgacgcgcgccatgcgcgaggtcatgctcggc
gaagaccctcccgtggtgctcacccggcgggcccaggcgcgactggccgagcagcgcgag
agcgatgcacccgacaccgtgcacccggacggcacgctggtcacccgtgcaggcaacgac
gtccgctggtggacctgggccggataccgcgccaacgccaccctcgcggccaccctgcag
tcagtcaccgacccactgcagcgccccaccgactgctggctgcgcctgcgcgaggacctc
gacccggccgactggcacgccgcccgaaagagcgtcggtgaaagccttgtcctgcccgac
gtcgacccacgcgctgtacgtggtctcaagttctccgccgcgctccccgaacgccttgcg
atcgcgacggtggccgcccgactggccgacttcgacagcgcatggttcgtactgtcggag
gccgtgcgcttcgtcgtctccagcgatcgcgcctga

DBGET integrated database retrieval system