KEGG   Streptomyces coelicolor: SCO6659Help
Entry
SCO6659           CDS       T00085                                 

Gene name
pgi
Definition
(RefSeq) glucose-6-phosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
sco  Streptomyces coelicolor
Pathway
sco00010  Glycolysis / Gluconeogenesis
sco00030  Pentose phosphate pathway
sco00500  Starch and sucrose metabolism
sco00520  Amino sugar and nucleotide sugar metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
Module
sco_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO6659 (pgi)
   00030 Pentose phosphate pathway
    SCO6659 (pgi)
   00500 Starch and sucrose metabolism
    SCO6659 (pgi)
   00520 Amino sugar and nucleotide sugar metabolism
    SCO6659 (pgi)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sco04147]
    SCO6659 (pgi)
Enzymes [BR:sco01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     SCO6659 (pgi)
Exosome [BR:sco04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SCO6659 (pgi)
  Exosomal proteins of other body fluids (saliva and urine)
   SCO6659 (pgi)
  Exosomal proteins of colorectal cancer cells
   SCO6659 (pgi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGI
Motif
Other DBs
NCBI-GeneID: 1102098
NCBI-ProteinID: NP_630734
Kitasato: SCO6659
UniProt: O88015
Position
complement(7395031..7396683)
Genome map
AA seq 550 aa AA seqDB search
MSDTPKLNQRPEWTALADHAKGTLPHPDLRELFAQDPGRAERYVVRVGDLRIDYSKHLVT
DETLALLQELAAATGVSGLRDAMFRGERINITEDRAVLHTALRAPRDAVIEVDGENVVPQ
VHAVLDKMAGFADRVRSGEWTGHTGRRIRNVVNIGIGGSDLGPAMAYEALRAFTDRSLTL
RFVSNVDGADLHEAVRDLDPAETLFIIASKTFTTIETITNATSARSWLLDGLGGDEKAVA
KHFVALSTNAEKVADFGIDTANMFEFWDWVGGRYSFDSAIGLSLMIAIGPDRFREMLDGF
RIVDEHFRNAEAPANAPLLLGLLGVWYGDFLGAQSHAVLPYSHYLSKFTAYLQQLDMESN
GKSVDREGNPVQWQTGPVVWGTPGTNGQHAYYQLIHQGTKLIPADFIGFARPVDELSEEL
KAQHDLLMANFFAQTQALAFGKTPDEVRAEGVPEELVPHKTFRGNHPTTTVLAAELTPSV
LGQLIALYEHKVFVQGAIWNIDSFDQWGVELGKVLAKRVEPALTEGADVPGLDPSTAALV
AAYRELKEVH
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaccccgaagctcaaccagcggcccgagtggaccgcgctcgcggaccacgcc
aagggcacgctgccccacccggacctgcgcgagctgttcgcccaggaccccgggcgggcg
gagcgctacgtcgtgcgcgtgggagacctgcgcatcgactactcgaagcacctggtcacc
gacgagacgctggccctgctccaggagctggccgccgcgaccggcgtgtccgggctgcgt
gacgcgatgttccgcggtgagcgcatcaacatcaccgaggaccgggcggtcctgcacacc
gcgctgcgggcgccgcgggacgcggtgatcgaggtcgacggcgagaacgtcgtcccccag
gtgcacgccgtgctggacaagatggccggcttcgccgaccgggtccgctccggcgagtgg
accggccacaccggcaggcgcatcaggaacgtcgtcaacatcggcatcggcggctccgac
ctcggtccggcgatggcctacgaggccctgcgggccttcaccgaccgctccctcaccctc
cgcttcgtgtccaacgtggacggcgccgacctgcacgaggcggtccgggacctggacccg
gccgagacgctgttcatcatcgcctccaagaccttcaccaccatcgagacgatcaccaac
gccacctccgcccgctcgtggctgctggacggcctcgggggtgacgagaaggcggtcgcg
aagcacttcgtggccctgtcgaccaacgccgagaaggtcgcggacttcggcatcgacacg
gccaacatgttcgagttctgggactgggtcggcggccgctactccttcgactcggccatc
ggcctctccctgatgatcgccatcggcccggaccgcttccgggagatgctcgacggcttc
cgcatcgtcgacgagcacttccgcaacgccgaggccccggccaacgcgccgctgctcctc
ggcctgctgggcgtctggtacggcgacttcctgggtgcgcagtcacacgcggtgctgccg
tactcgcactacctgtcgaagttcaccgcgtacctgcagcagctcgacatggagtccaac
ggcaagtccgtcgaccgggaggggaacccggtccagtggcagaccgggccggtggtctgg
ggtacacccggcaccaacgggcagcacgcctactaccagttgatccaccagggtacgaag
ctgatcccggcggacttcatcggcttcgcccggcccgtggacgagctgagcgaggagctg
aaggcccagcacgacctgctgatggccaacttcttcgcccagacccaggccctcgccttc
ggcaagacccccgacgaggtacgcgccgagggagtgcccgaggaactggtcccgcacaag
accttccgcggcaaccaccccaccacgaccgtcctggccgccgaactgaccccctccgtc
ctcggccagctcatcgccctgtacgagcacaaggtcttcgtccagggcgcgatctggaac
atcgactccttcgaccagtggggcgtcgaactcggcaaggtgctcgccaagcgcgtcgaa
ccggccctcaccgagggcgcggacgtgcccggcctcgatccgtccacggccgcgctggtg
gccgcctaccgtgaactgaaggaagtgcactga

DBGET integrated database retrieval system