KEGG   Streptomyces coelicolor: SCO6662Help
Entry
SCO6662           CDS       T00085                                 

Gene name
tal1
Definition
(RefSeq) transaldolase
  KO
K00616  transaldolase [EC:2.2.1.2]
Organism
sco  Streptomyces coelicolor
Pathway
sco00030  Pentose phosphate pathway
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
sco01230  Biosynthesis of amino acids
Module
sco_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
sco_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SCO6662 (tal1)
Enzymes [BR:sco01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.2  transaldolase
     SCO6662 (tal1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TAL_FSA
Motif
Other DBs
NCBI-GeneID: 1102101
NCBI-ProteinID: NP_630737
Kitasato: SCO6662
UniProt: O88018
Position
complement(7399383..7400528)
Genome map
AA seq 381 aa AA seqDB search
MITVTEATATAGALQRLADQGVSVWLDDLSRRRIESGNLAELIRTKNVVGVTTNPSIFQA
AIGSGEGYEEQLADLATRGVTVDEAVRMMTTADVRAAADVLRGVYDASGGRDGRVSIEVD
PRLAHDTAATVAEARQLSWLVDRPNVMIKIPATKAGLPAITEVIGAGISVNVTLIFSLER
YREVMDAYLAGLEKAQAAGIDLAGIHSVASFFVSRVDSEIDKRLSLLGTEEALGLRGRAA
LANARLAYEAYENVFAGDRFTALAGARANAQRPLWASTGVKDPAFRDTLYVEELVAPGTV
NTMPEATLDAAADHGDVRGDTVTGGYAQARADLAAVERLGVSYDEVVEQLEQEGVAKFEA
AWQELLAAVTKSLDSKGVDGE
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgatcactgtgaccgaagcaaccgccaccgcgggagcactgcagcgcctggccgaccag
ggcgtgtccgtctggctcgacgacctgtcgcggcggcggatcgagtccggcaacctcgcc
gagctgatcaggacgaagaacgtcgtcggagtcaccaccaacccgtcgatcttccaggcc
gccataggctccggcgagggctacgaggagcaactcgccgacctggcgacccggggcgtc
accgtcgacgaggcggtccgcatgatgaccaccgccgatgtccgcgccgccgccgacgtg
ctgcgcggggtgtacgacgcctccggcgggcgcgacggccgcgtctccatcgaggtcgac
ccgcgcctggcccacgacacggcggcgacggtcgccgaggcccgccagctgtcctggctg
gtcgaccgtcccaacgtgatgatcaagatcccggcgacgaaggccggtctcccggccatc
accgaggtcatcggcgccggcatcagtgtgaacgtcacgctgatcttctccctggagcgc
taccgcgaggtcatggacgcctacctcgccggcctggagaaggcgcaggcggccgggatc
gacctggccggcatccactcggtcgcgtccttcttcgtctcccgcgtcgacagcgagatc
gacaagcgcctgtccctgctgggcaccgaagaggcgctcggcctgcgcggccgggcggca
ctggccaacgcacgactggcctacgaggcgtacgagaacgtcttcgcgggcgaccgcttc
accgccctcgcgggggcccgcgcgaacgcccagcgccccctgtgggcgtccaccggtgtg
aaggacccggcattccgggacaccctgtacgtggaggagctggtcgcccccggcaccgtg
aacacgatgccggaggccaccctggacgccgccgccgatcacggcgacgtacggggcgac
acggtcaccggcgggtacgcccaggcccgcgccgatctcgcggccgtggagcggctcggc
gtgtcgtacgacgaggtggtggagcagttggagcaggagggcgtggcgaagttcgaggcg
gcctggcaggagctgctcgccgccgtgacgaagtccctcgacagcaagggagttgacggg
gaatga

DBGET integrated database retrieval system