KEGG   Streptomyces coelicolor: SCO6663Help
Entry
SCO6663           CDS       T00085                                 

Gene name
tktB
Definition
(RefSeq) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
sco  Streptomyces coelicolor
Pathway
sco00030  Pentose phosphate pathway
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
sco01230  Biosynthesis of amino acids
Module
sco_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
sco_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SCO6663 (tktB)
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    SCO6663 (tktB)
Enzymes [BR:sco01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     SCO6663 (tktB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N TPP_enzyme_C
Motif
Other DBs
NCBI-GeneID: 1102102
NCBI-ProteinID: NP_630738
Kitasato: SCO6663
UniProt: O88019
Position
complement(7400592..7402688)
Genome map
AA seq 698 aa AA seqDB search
MSTQSSKQTVDGADRFEWTELDRRAVDTARILAADAVQKVGNGHPGTAMALAPAAYTIFQ
KVMRHDPADPEWTGRDRFVLSPGHTSLTLYTQLFLAGYEVELDDLKAFRTHGSRTPGHPE
YGHTAGVETTTGPLGQGVANAVGMAMAARYERGLFDPEAPEGESPFDHTIWAIVSDGDLQ
EGVSAEASSLAGHQKLGNLVFLYDDNHISIEGDTVTAFSEDVLKRYEAYGWHTQRVEPAE
SGDVDVRALHAAMTAAKAETGRPSIIAMRTIIAWPAPNAQNTEASHGSALGADEIAATKR
VLGFDPERSFEVADEVLAHTRRALDRGAEAHAAWDKRIAAWRDAAPERAALFDRVVAGRL
PEGWENALPVFETGKAVATRAASGKVLQALGPVLPELWGGSADLAGSNNTTIDKTSSFLP
GGNPLPGADPYGRTVHFGIREFSMAAEMNGIALHGNTRIYGGTFLVFSDYMRNAVRMSAL
MQLPVTYVWTHDSIGLGEDGPTHQPVEHLASLRAIPGLNVVRPADANETATVWAEILRRH
STHPAPHGLALTRQGVPTYAPNPDAARGGYVLADASTGAPDVVLIATGSEVQLAMAARET
LEAEGTATRVVSMPSVEWFEEQPRAYRESVLPPSVRARVAVEAGIGLTWHRFVGDAGRIV
SLEHFGASADAKTLFSEFGFTAGHVAAAARDSLAAARG
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcagtcgagcaagcagacagtggacggcgcggaccgcttcgaatggaccgaa
ctcgaccggcgtgccgtggacaccgcccggatcctggcggccgacgccgtgcagaaggtg
ggcaacggtcacccgggtacggcgatggccctcgccccggccgcctacacgatctttcag
aaggtgatgcggcacgaccccgccgatcccgagtggaccggccgtgaccgcttcgtcctc
tcccccggccacacctcgctgaccctctacacccagctcttcctcgccgggtacgaggtg
gagctggacgacctcaaggccttccgcacgcacggctccaggacgccgggccaccccgag
tacgggcacacggccggcgtggagaccaccacggggccgctgggccagggtgtggccaac
gcggtgggcatggcgatggcggcccgctacgagcgcggcctgttcgaccccgaggccccc
gagggcgagtcgcccttcgaccacaccatctgggcgatcgtcagcgacggcgacctccag
gagggcgtctccgcggaggcgtcgtcgctcgccggtcaccaaaagctcggcaatctggtc
ttcctctacgacgacaaccacatctcgatcgagggcgacaccgtgaccgcgttctccgag
gacgtgctgaagcgctacgaggcgtacggctggcacacacagcgcgtcgagcccgccgag
agcggcgacgtggacgtgcgcgcgctgcacgcggcgatgacggcggcgaaggccgagacc
ggccgcccctccatcatcgccatgcgcacgatcatcgcctggcccgccccgaacgcccag
aacaccgaggcctcccacggctccgccctcggcgcggacgagatcgccgccaccaagcgc
gtcctcggcttcgacccggagcggtccttcgaggtcgccgacgaggtcctcgcccacacc
cgccgggccctggaccggggcgccgaggcgcacgccgcctgggacaagcggatcgccgcc
tggcgcgacgccgcccccgagcgcgcggcgctgttcgaccgcgtggtcgcgggccggctg
cccgagggctgggagaacgccctgccggtgttcgagaccggcaaggcggtcgccacccgg
gccgcgtccggcaaggtcctccaggcgctcggcccggtgctgcccgaactgtggggcggc
tccgcagacctggccggctcgaacaacacgacgatcgacaagacgtcgtccttcctgccc
gggggcaacccgctccccggcgccgacccgtacggccgcaccgtgcacttcggcatccgc
gagttctccatggccgcggagatgaacggcatcgccctgcacggcaacacccggatctac
ggcggcaccttcctggtcttctccgactacatgcgcaacgcggtgcgcatgtccgcgctg
atgcagctgccggtgacgtacgtgtggacgcacgactccatcggcctcggtgaggacggg
cccacccaccagccggtcgaacacctggcctcgctgcgcgcgatccccggcctcaacgtc
gtccgccccgccgacgccaacgagaccgcgaccgtgtgggccgagatcctgcgccgccac
tccacccacccggcgccgcacggcctcgccctcacccgccagggcgtaccgacctacgcg
ccgaacccggacgcggcgcgcggcgggtacgtcctcgccgacgcgtccaccggcgccccg
gacgtcgtcctgatcgccaccggctccgaggtgcagctcgcgatggccgcgcgggagacg
ctggaggccgagggcaccgccacgcgcgtggtgtcgatgccgtccgtggagtggttcgag
gagcagccccgcgcctaccgcgagagcgtgctgccgccgtccgtgcgggcccgggtggcc
gtggaggccgggatcggcctgacctggcaccggttcgtcggggacgcgggccgcatcgtc
tccctggagcacttcggcgcctccgccgacgcgaagaccctgttcagcgagttcggcttc
accgccgggcacgtggccgccgccgcccgggactccctggccgccgcccgcggctga

DBGET integrated database retrieval system