KEGG   Streptomyces coelicolor: SCO6701Help
Entry
SCO6701           CDS       T00085                                 

Gene name
pcaF, SC4C6.11c
Definition
(RefSeq) beta-ketoadipyl-CoA thiolase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
sco  Streptomyces coelicolor
Pathway
sco00071  Fatty acid degradation
sco00280  Valine, leucine and isoleucine degradation
sco00281  Geraniol degradation
sco00362  Benzoate degradation
sco00592  alpha-Linolenic acid metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01212  Fatty acid metabolism
Module
sco_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SCO6701 (pcaF)
   00592 alpha-Linolenic acid metabolism
    SCO6701 (pcaF)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCO6701 (pcaF)
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    SCO6701 (pcaF)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SCO6701 (pcaF)
   00642 Ethylbenzene degradation
    SCO6701 (pcaF)
Enzymes [BR:sco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     SCO6701 (pcaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 1102140
NCBI-ProteinID: NP_630774
Kitasato: SCO6701
UniProt: Q9XAM9
Position
complement(7453156..7454358)
Genome map
AA seq 400 aa AA seqDB search
MKDVYLVDAVRTPFGKYNGGLSGVRPDDLAAHAIRELLGRTPGLDPSRIDDVYFGNANGA
GEENRNVARMAALLAGLPTTVPGVTVNRLCASGLEAVIQAARAIAVGDASVALAGGVESM
TRAPYVLPKPDRPFPAGHTEMYSTTLGWRMVNPAMDPQWTIPLGESAELIADKHGITREQ
QDEYALASHRKAARAQADGLFDAELAPVPVPRRKGDPVDFAADECVRPDASLEAMAKLKP
SFRKTDGTVTAGNASPLNDGAAALLLVDEEGLKATGREPLARVSATGVSATDPQYFGLAP
VEAVNRALARAGRDFADLDVLELNEAFAAQVLGCVAEWPEFDPAVLNPQGGAIALGHPLG
ASGARLAGTVAHQLARRGSGTGIATLCIGVGQGLALVLDR
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggacgtctacctcgtcgacgcggtgcgcaccccgttcggcaagtacaacgggggc
ctgtcgggcgtacgcccggacgacctggccgcgcacgcgatccgtgaactcctgggccgt
acgcccggcctggacccgtcccggatcgacgacgtgtacttcggcaacgccaacggcgcc
ggcgaggagaaccgcaacgtcgcccgcatggccgccctgctggccggcctgcccaccacc
gtccccggcgtcacggtgaaccggctgtgcgcctccggcctcgaagcggtgatccaggcc
gcccgtgccatcgcggtcggcgacgcctcggtcgcactcgcgggcggcgtggagtcgatg
acccgggccccgtacgtgctgcccaagccggaccggcccttccccgccgggcacaccgag
atgtactcgaccaccctgggctggcgcatggtcaacccggcgatggacccgcagtggacg
atcccgctcggcgagtcggcggagctgatcgcggacaagcacgggatcacccgcgagcag
caggacgagtacgccctcgcctcccaccgcaaagccgcccgcgcccaggccgacggcctg
ttcgacgccgagctggcgcccgtgccggtgccgcgccgcaagggcgacccggtcgacttc
gccgccgacgagtgcgtccgcccggacgcctccctggaggcgatggccaaactcaagccg
tccttcaggaagaccgacggcaccgtgaccgcgggaaacgcctcgccgctcaacgacggc
gccgccgcgctgctcctggtcgacgaggagggactgaaggccaccggacgcgagccgctc
gcccgggtctcggccaccggggtctcggcgaccgacccgcagtacttcggtctcgccccc
gtggaggcggtgaaccgggcgctcgcccgggccggacgggacttcgccgacctggacgtg
ctcgaactcaacgaagccttcgccgcccaggtgctgggctgcgtcgccgagtggccggag
ttcgacccggcggtcctcaacccgcagggcggggccatcgccctcggccacccgctcggc
gcgtccggcgcccggctcgccggcaccgtcgcccaccagctcgcccgcaggggaagcggc
accggcatcgccaccctctgcatcggcgtcggccagggcctcgccctggtcctcgaccgc
tag

DBGET integrated database retrieval system