KEGG   Streptomyces coelicolor: SCO6702Help
Entry
SCO6702           CDS       T00085                                 

Gene name
pcaJ, SC4C6.12c
Definition
(RefSeq) 3-oxoadipate CoA-transferase subunit B
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
sco  Streptomyces coelicolor
Pathway
sco00072  Synthesis and degradation of ketone bodies
sco00280  Valine, leucine and isoleucine degradation
sco00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SCO6702 (pcaJ)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    SCO6702 (pcaJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCO6702 (pcaJ)
Enzymes [BR:sco01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     SCO6702 (pcaJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Motif
Other DBs
NCBI-GeneID: 1102141
NCBI-ProteinID: NP_630775
Kitasato: SCO6702
UniProt: Q9XAM8
Position
complement(7454355..7455008)
Genome map
AA seq 217 aa AA seqDB search
MSWTREQMAARAALELEDGQYVNLGIGLPTLIPNYLPDGVEVTLESENGILGTGRYPTDA
EVDPDLINAGKETVTVRPGAAFFDSALSFGMIRGGHIDVAVLGAMQVSASGDLANWAIPG
KMITGIGGAMDLVHGARTVIVVMTHTAKDGSPKILKKCALPLTGKACVDRVITDLGVLDV
TGDGLVLVETAPGVSVDEVVARTDAELVVAKSAEGLK
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgtcctggacgcgtgagcagatggccgcgcgggcggcgctggagctggaggacggccag
tacgtcaacctcggcatcggcctgcccaccctgatcccgaactacctccccgacggcgtc
gaggtcaccctggagtcggagaacggcatcctgggcaccggccggtaccccaccgacgcc
gaggtggaccccgacctgatcaacgcgggcaaggagacggtcacggtacggccgggcgcc
gccttcttcgactcggccctgtccttcggcatgatccggggcgggcacatcgacgtggcg
gtgctcggcgcgatgcaggtctccgcctccggcgacctcgcgaactgggcgatcccgggc
aagatgatcaccgggatcggcggcgcgatggacctcgtccacggcgcccgcaccgtcatc
gtggtcatgacccacaccgccaaggacggctcgcccaagatcctcaagaagtgcgccctg
ccgctcaccggcaaggcgtgcgtcgaccgcgtcatcaccgacctcggcgtcctcgacgtc
accggcgacggcctggtcctggtggagaccgcaccgggcgtgagcgtcgacgaggtcgtc
gccaggaccgatgccgagctcgtcgtcgcgaagagcgcggaggggctgaagtga

DBGET integrated database retrieval system