KEGG   Streptomyces coelicolor: SCO6732Help
Entry
SCO6732           CDS       T00085                                 

Gene name
SC5F2A.15
Definition
(RefSeq) fatty acid oxidative multifunctional enzyme
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
sco  Streptomyces coelicolor
Pathway
sco00071  Fatty acid degradation
sco00280  Valine, leucine and isoleucine degradation
sco00281  Geraniol degradation
sco00310  Lysine degradation
sco00362  Benzoate degradation
sco00380  Tryptophan metabolism
sco00410  beta-Alanine metabolism
sco00640  Propanoate metabolism
sco00650  Butanoate metabolism
sco00903  Limonene and pinene degradation
sco00930  Caprolactam degradation
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
sco01212  Fatty acid metabolism
Module
sco_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SCO6732 (SC5F2A.15)
   00650 Butanoate metabolism
    SCO6732 (SC5F2A.15)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SCO6732 (SC5F2A.15)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCO6732 (SC5F2A.15)
   00310 Lysine degradation
    SCO6732 (SC5F2A.15)
   00380 Tryptophan metabolism
    SCO6732 (SC5F2A.15)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SCO6732 (SC5F2A.15)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SCO6732 (SC5F2A.15)
   00281 Geraniol degradation
    SCO6732 (SC5F2A.15)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SCO6732 (SC5F2A.15)
   00930 Caprolactam degradation
    SCO6732 (SC5F2A.15)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SCO6732 (SC5F2A.15)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SCO6732 (SC5F2A.15)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SCO6732 (SC5F2A.15)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 F420_oxidored DAO AlaDh_PNT_C NAD_binding_8 NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-GeneID: 1102171
NCBI-ProteinID: NP_630805
Kitasato: SCO6732
UniProt: Q9X7N8
Position
7485381..7487561
Genome map
AA seq 726 aa AA seqDB search
MSTEPTTIRWEQDDTGVVTLVLDDPDQSANTMNQAFRDSLAAVTDRLEAEKDSIRGVIVT
SAKKTFFAGGDLRDLIRVTPETAQDLFDGGMAIKRNLRRIETLGKPVVAALNGAALGGGY
EIALACHHRVALDAPGSKIGCPEVTLGLLPGGGGVVRTVRMLGITDALLKVLLQGTQYNP
RRAQENGLVDEVADSREDMLAKARAFIDAHPESAQPWDRPGYRIPGGTPSHPKFAANLPA
FPANLRKQTNGAPYPAPRNIMAAAVEGSQVDFETAQVIEARYFVELAAGQTSKNMIQAFF
FDLQAVNSGANRPKGVEPGKVAKVAVLGAGMMGAGIAYSCARAGIDVVLKDVSLESALKG
KAYSEKLCAKAVAKGRTSQEKAAALLARITPTAEAADLAGCDAVIEAVFEDTSLKHKVFQ
EIEHVVAPDALLCSNTSTLPITALAEGVERQGDFIGLHFFSPVDRMPLVEIIKGERTGDE
ALARAFDLVRQIGKTPIVVNDSRGFFTSRVIGHFINEGVAMVGEGIEPASVEQAAAQAGY
PAKVLSLMDELTLTLPRKIREETKRAVEEAGGTWAAHPAEALIDRMVDEFGRPGRSGGAG
FYEYGEDGRRAGLWPGLREHFTKPGYEIPFADMQERMLFSEALDTVRLLEEGVLTSVADA
NIGSIFGIGFPGWTGGVLQYINGYDGGVPGFVARARELADRYGERFTPPALLVEKADNGE
VFTDGR
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgagcccaccaccatccgctgggagcaggacgacaccggtgtcgtcaccctc
gtcctcgacgaccccgaccagtccgcgaacaccatgaaccaggcgttccgcgactccctg
gcggcggtcaccgaccgcctggaggccgagaaggactcgattcgcggcgtcatcgtcacc
tccgccaagaagaccttcttcgcgggcggcgacctgcgcgacctcatccgcgtcaccccg
gagaccgcgcaggacctcttcgacggcggcatggccatcaagcggaacctgcgccgcatc
gagaccctcggcaagcccgtcgtcgccgccctgaacggcgcggccctcggcggcggctac
gagatcgcgctggcctgccaccaccgcgtcgccctggacgcccccggctccaagatcggc
tgccccgaggtcaccctcggcctgctccccggaggcggcggagtcgtccgcaccgtccgg
atgctcggcatcaccgatgccctgctgaaggtcctcctccagggcacccagtacaacccg
cgccgcgcccaggagaacggcctggtcgacgaggtcgccgacagccgcgaggacatgctc
gccaaggcccgcgccttcatcgacgcccacccggagtccgcccagccctgggaccggccc
ggttaccgcatccccggcggcaccccgtcccacccgaagttcgcggccaacctgcccgcc
ttccccgccaacctgcgcaagcagacgaacggcgccccctacccggcgccgcgcaacatc
atggccgccgccgtcgagggctcccaggtcgacttcgagaccgcccaggtcatcgaggcc
cgctacttcgtcgaactggccgccgggcagacctcgaagaacatgatccaggcgttcttc
ttcgacctgcaggcggtcaattccggtgccaaccgtccgaagggtgtcgagccggggaag
gtcgccaaggtggccgtgctgggtgcggggatgatgggtgcgggcatcgcctactcgtgt
gcgcgtgcgggcatcgacgtggtgctgaaggacgtctccctggagtcggcgctcaagggc
aaggcgtattcggagaagctgtgcgccaaggccgtcgcgaagggccgtacgagtcaggag
aaggcggccgcgctgctggcgcggatcacgccgacggccgaggcggccgacctggcgggg
tgcgacgcggtgatcgaggcggtgttcgaggacacctcgctcaagcacaaggtgttccag
gagatcgagcacgtcgtcgcccccgacgccctgctgtgctcgaacacctccacgctgccg
atcacggcgctggccgagggggtggagcggcagggcgacttcatcgggctgcacttcttc
tcacccgtggacaggatgccgctggtggagatcatcaagggcgagcggaccggggacgag
gccctggcccgcgccttcgacctggtccggcagatcggcaagacgccgatcgtggtcaac
gactcgcggggcttcttcacctcccgggtcatcggccacttcatcaacgagggcgtggcg
atggtgggggagggcatcgagcccgcctcggtggagcaggcggcggcccaggcgggttac
ccggccaaggtgctgtccctgatggacgagctgaccctcaccctcccccgcaagatccgc
gaggagacgaagcgggcggtggaggaggcgggcggcacctgggcggcgcatcccgccgag
gcgctcatcgaccgcatggtcgacgagttcggccgcccgggacgctccggaggtgccggg
ttctacgagtacggcgaggacggcaggcgggccggactgtggccggggctgcgcgagcac
ttcacgaagccggggtacgagatcccgttcgccgacatgcaggagcggatgctgttctcg
gaggcgctggacaccgtccggctcctggaggagggggtgctgacctccgtcgccgacgcc
aacatcggctcgatcttcggcatcggcttccccggctggaccggcggcgtcctccagtac
atcaacggatacgacggcggcgtgccgggcttcgtcgcccgcgcccgcgagctggccgac
cgctacggcgagcgcttcaccccgcccgccctgctggtggagaaggcggacaacggggag
gtcttcacggacggccgctga

DBGET integrated database retrieval system