KEGG   Streptomyces coelicolor: SCO6787Help
Entry
SCO6787           CDS       T00085                                 

Gene name
acdH3, SC6A5.36
Definition
(RefSeq) acyl-CoA dehydrogenase
  KO
K00249  acyl-CoA dehydrogenase [EC:1.3.8.7]
Organism
sco  Streptomyces coelicolor
Pathway
sco00071  Fatty acid degradation
sco00280  Valine, leucine and isoleucine degradation
sco00410  beta-Alanine metabolism
sco00640  Propanoate metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
sco01212  Fatty acid metabolism
Module
sco_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SCO6787 (acdH3)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SCO6787 (acdH3)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCO6787 (acdH3)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SCO6787 (acdH3)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.7  medium-chain acyl-CoA dehydrogenase
     SCO6787 (acdH3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2 Acyl-CoA_ox_N Taq-exonuc
Motif
Other DBs
NCBI-GeneID: 1102226
NCBI-ProteinID: NP_630859
Kitasato: SCO6787
UniProt: Q9X7Y2
Position
7544744..7545892
Genome map
AA seq 382 aa AA seqDB search
MTFRRDLYGPDHEAFRDTVRAFLAKEVAPHHQRWERNGVVDREVWYSAGRQGLLGPAVDQ
EYGGGGSDDFRYSAVLIEEFARAGASGLALSLHNDIVGPYLTRLATEEQKRRWLPGFVSG
DIVTAIAMTEPGAGSDLQGIRTTATDRGDHYLLNGSKTFISNGILADLVVVVARTTPEGG
SAGQSLLVVERGADGFERGRNLAKIGQQAQDTAELFFNDVHVPKENLLGEENRAFTYLMG
NLAQERLAIAVGAAAATEEILDITTRYVKEREAFGRPLAKLQHVRFEIAEMATEAAVTRT
FLDRCVTEHVAGRLDPVHASMAKWWATELQKRVVDRCLQLHGGYGYMSEYRVARAFLDGR
IQTIYGGTTEIMKEIIGRSLLG
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtgaccttccgacgagacctgtacggccccgatcacgaggccttccgcgacaccgtgcgc
gccttcctcgccaaggaggtggcgccgcaccaccaacgctgggaacgcaacggcgtcgtc
gaccgcgaggtctggtactcggcgggccgccagggcctgctgggtccggccgtcgaccag
gagtacggcggtggtggcagcgacgacttccgctacagcgccgtcctcatcgaggagttc
gcccgcgccggagcctccggactggccctgagcctgcacaacgacatcgtcggcccgtac
ctcacccggctcgccaccgaggaacagaagcggcgctggctgcccggcttcgtctccggc
gacatcgtcaccgccatcgccatgaccgaacccggagccggttccgacctccagggcatc
cgcaccacggccaccgaccgcggcgaccactacctgctcaacggctcgaagaccttcatc
tccaacggcatcctcgccgacctcgtcgtggtggtcgcccgcaccacgcccgagggcggc
agtgccgggcagagcctgctcgtcgtcgaacgcggcgcggacggcttcgaacgaggccgc
aacctcgccaagatcggccagcaggcccaggacaccgccgagctgttcttcaacgacgta
cacgtccccaaggagaacctgctcggcgaggagaaccgcgccttcacctacctgatgggc
aacctcgcccaggagcgtctggccatcgcggtcggcgccgcggcggcgaccgaggagatc
ctcgacatcaccacgcgctacgtgaaggagcgcgaggccttcggccggccgctggccaaa
ctccagcacgtccgcttcgagatcgccgagatggccaccgaggcggcggtcacccgcacc
ttcctggaccgctgtgtcaccgagcacgtcgcgggccggctcgatcccgtgcacgcctcg
atggccaagtggtgggccaccgaactccagaagcgggtcgtcgaccgctgtctgcaactc
cacggcggctacggctacatgagcgagtaccgggtggcgcgggcgttcctcgacgggcgc
atccagaccatctacggcggcaccaccgagatcatgaaggagatcatcggccgctccctc
ctgggttga

DBGET integrated database retrieval system