KEGG   Streptomyces coelicolor: SCO6799Help
Entry
SCO6799           CDS       T00085                                 

Gene name
tdh
Definition
(RefSeq) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
sco  Streptomyces coelicolor
Pathway
sco00260  Glycine, serine and threonine metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO6799 (tdh)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     SCO6799 (tdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C FAD_binding_3 AlaDh_PNT_C HI0933_like FAD_binding_2 Methyltransf_25 Pyr_redox_2 Pyr_redox_3 FAD_oxidored Pyr_redox ADH_zinc_N_2 TrkA_N 3HCDH_N
Motif
Other DBs
NCBI-GeneID: 1102238
NCBI-ProteinID: NP_630871
Kitasato: SCO6799
UniProt: Q9L233
Position
7559630..7560658
Genome map
AA seq 342 aa AA seqDB search
MKALVKENAEPGLWLADVPEPTIGSGDVLIKVLRTGICGTDLHIRAWDGWAQQAIRTPLV
VGHEFVGEVVDTGRDVTDIKAGDRVSGEGHLVCGKCRNCLAGRRHLCRATVGLGVGRDGA
FAEYVALPASNVWVHRVPVDLDVAAIFDPFGNAVHTALSFPLVGEDVLITGAGPIGLMAA
AVARHAGARNVVITDVSEERLELARKVGATLALNVSDATIADGQRELGLREGFDIGLEMS
GRPEAMRDMIANMTHGGRIAMLGLPAEEFPVDWARVVTSMITVKGIYGREMFETWYAMSV
LLEGGLDLAPVITGRYSHRDFEAAFADAASGRGGKVILDWTA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggcgctggtcaaggagaacgcggagcccgggctgtggctcgcggacgtcccggag
cccaccatcgggtccggtgacgtcctcatcaaggtgctgcgcaccggcatctgcggcacc
gacctgcacatccgggcctgggacggctgggcgcagcaggccatccgcaccccgctcgtc
gtcggccacgagttcgtcggcgaggtcgtcgacaccgggcgcgacgtcaccgacatcaag
gccggcgaccgggtcagcggcgagggccacctggtctgcggcaagtgccgcaactgcctg
gccggccggcgccacctgtgccgcgccaccgtcggcctcggcgtcggccgggacggggcg
ttcgccgagtacgtggccctgcccgcgtccaacgtctgggtgcaccgcgtccccgtcgac
ctcgacgtcgccgcgatcttcgacccgttcggcaacgccgtgcacaccgcgctgtccttc
ccgctggtcggcgaggacgtcctcatcaccggcgccggaccgatcggcctgatggccgcc
gccgtggcccggcacgccggcgcccgcaacgtcgtcatcacggacgtgagcgaggagcgg
ctggaactggcccgcaaggtcggcgccaccctcgccctgaacgtttcggacgccaccatc
gccgacggacagcgcgaactgggcctgcgcgagggcttcgacatcggcctggagatgtcc
ggccgtcccgaggccatgcgcgacatgatcgccaacatgacgcacggcggccggatcgcc
atgctcggcctgcccgccgaggagttcccggtcgactgggcccgcgtcgtcacctccatg
atcaccgtcaagggcatctacggccgcgagatgttcgagacctggtacgccatgtccgtg
ctgctcgaaggcggcctcgacctcgcccccgtgatcaccggccgctactcccaccgcgac
ttcgaggccgcgttcgccgacgcggcgagcggccgcggcggcaaggtcatcctcgactgg
accgcgtaa

DBGET integrated database retrieval system