KEGG   Streptomyces coelicolor: SCO6800Help
Entry
SCO6800           CDS       T00085                                 

Gene name
kbl, SC1A2.09
Definition
(RefSeq) 2-amino-3-ketobutyrate coenzyme A ligase
  KO
K00639  glycine C-acetyltransferase [EC:2.3.1.29]
Organism
sco  Streptomyces coelicolor
Pathway
sco00260  Glycine, serine and threonine metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO6800 (kbl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sco01007]
    SCO6800 (kbl)
Enzymes [BR:sco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.29  glycine C-acetyltransferase
     SCO6800 (kbl)
Amino acid related enzymes [BR:sco01007]
 Aminotransferase (transaminase)
  Class II
   SCO6800 (kbl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 SHMT DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase OKR_DC_1
Motif
Other DBs
NCBI-GeneID: 1102239
NCBI-ProteinID: NP_630872
Kitasato: SCO6800
UniProt: Q9L232
Position
7560698..7561891
Genome map
AA seq 397 aa AA seqDB search
MFDSVRDDLRATLDEIRAAGLHKPERVIGTPQSATVNVTAGGRPGEVLNFCANNYLGLAD
HPEVVAAAHEALDRWGYGMASVRFICGTQEVHKELEARLSAFLGQEDTILYSSCFDANGG
VFETLLGPEDAVISDALNHASIIDGIRLSKAKRLRYANRDMADLEAQLKAAGEARRKLIV
TDGVFSMDGYVAPLDEICDLADRYDAMVMVDDSHAVGFVGPGGRGTPELHGVMDRVDIIT
GTLGKALGGASGGYVAARAEIVALLRQRSRPYLFSNTLAPVIAAASLKVLDLLESADDLR
VRLAENTALFRRRMTDEGFDILPGDHAIAPVMIGDATKAGRMAELLLERGVYVIGFSYPV
VPQDKARIRVQLSAAHSTDDVNRAVDAFVAAREQLAA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgttcgactccgtgcgcgacgacctgcgcgccaccctcgacgagatccgcgccgccggc
ctgcacaagcccgagcgcgtcatcggcaccccgcagtccgcgaccgtcaacgtcaccgcg
ggcggccgccccggcgaggtcctcaacttctgcgccaacaactacctcggtctcgccgac
caccccgaggtcgtcgccgccgcccacgaggcgctggaccgctggggctacggcatggcg
tccgtgcgcttcatctgcggcacccaggaggtgcacaaggaactggaggcccggctctcc
gcgttcctcggccaggaggacacgatcctctactcctcctgcttcgacgccaacggcggc
gtcttcgagaccctgctgggccccgaggacgcggtgatctccgacgccctcaaccacgcc
tccatcatcgacggcatccggctgtccaaggccaagcggctgcgctacgccaaccgcgac
atggccgacctggaggcgcagctcaaggccgccggcgaggcccgccgcaagctgatcgtc
accgacggcgtcttctccatggacggctacgtcgccccgctcgacgagatctgcgacctc
gccgaccgctacgacgccatggtcatggtcgacgactcgcacgccgtcggcttcgtcggc
cccggcggccgcggcacccccgagctgcacggcgtcatggaccgcgtcgacatcatcacc
ggcaccctcggcaaggcgctcggcggcgcctccggcggctacgtcgcggcccgcgccgag
atcgtcgccctgctgcgccagcgctccaggccgtacctcttctccaacaccctcgccccg
gtgatcgccgccgcctccctcaaggtgctcgacctgctggagtcggccgacgacctgcgc
gtccggctcgccgagaacaccgcgctgttccgccgccggatgacggacgagggcttcgac
atcctccccggcgaccacgccatcgcgcccgtcatgatcggcgacgcgacgaaggcgggc
cgcatggcggagctgctcctggagcgcggcgtgtacgtgatcggcttctcctacccggtc
gtcccgcaggacaaggcccgcatccgcgtccagctgtccgccgcccactccacggacgac
gtcaaccgcgcggtggacgccttcgtggccgcccgggagcagctcgcggcctga

DBGET integrated database retrieval system