KEGG   Streptomyces coelicolor: SCO6818Help
Entry
SCO6818           CDS       T00085                                 

Gene name
SC1A2.27c.
Definition
(RefSeq) 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
  KO
K15633  2,3-bisphosphoglycerate-independent phosphoglycerate mutase [EC:5.4.2.12]
Organism
sco  Streptomyces coelicolor
Pathway
sco00010  Glycolysis / Gluconeogenesis
sco00260  Glycine, serine and threonine metabolism
sco00680  Methane metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
sco01230  Biosynthesis of amino acids
Module
sco_M00002  Glycolysis, core module involving three-carbon compounds
sco_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO6818 (SC1A2.27c.)
  09102 Energy metabolism
   00680 Methane metabolism
    SCO6818 (SC1A2.27c.)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO6818 (SC1A2.27c.)
Enzymes [BR:sco01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     SCO6818 (SC1A2.27c.)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Metalloenzyme iPGM_N Sulfatase Phosphodiest
Motif
Other DBs
NCBI-GeneID: 1102257
NCBI-ProteinID: NP_630890
Kitasato: SCO6818
UniProt: Q9L214
Position
complement(7579400..7580935)
Genome map
AA seq 511 aa AA seqDB search
MSTPEPVLAGPGILLVLDGWGSADAADDNALSLARTPVLDELVAQHPSTLAEASGEAVGL
LPGTVGNSEIGHMVIGAGRPLPYDSLLVQQAIDSGALRSHPRLDAVLNEVAATSGALHLI
GLCSDGQIHAHVEHLSELLAAAATHQVERVFIHAITDGRDVADHTGEAYLTRVAELAAAA
GTGQIATVIGRGYAMDKAGDLDLTERAVALVADGRGSPADSAHSAVHSSERGDEWVPASV
LTEAGDARVADGDAVLWFNFRSDRIQQFADRLHEHLTASGRTVNMVSLAQYDTRTAIPAL
VKRADASGGLADELQEAGLRSVRIAETEKFEHVTYYINGRDATVRDGEEHVRITGEGKAD
YVAHPHMNLDRVTDAVVEAAGRVDVDLVIANLANIDVVGHTGNLAATVTACEATDAAVDQ
ILQAARNSGRWVVAVGDHGNAERMTKQAPDGSVRPYGGHTTNPVPLVIVPNRTDTPAPTL
PGTATLADVAPTILHLLGHKPGPAMTGRPLL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacacccgaaccggtgctcgccggcccgggcatcctcctggtcctcgacggctgg
ggctccgccgacgcggccgacgacaacgccctgagcctcgcccgcaccccggtgctggac
gaactcgtggcccagcacccgagcacgctggccgaagcttccggtgaagcggtcggtctg
ctccccggtacggtcggcaactccgagatcggccacatggtcatcggagccggaaggccc
ctcccctacgacagcctcctggtccagcaggccatcgacagcggcgccctgcgcagccat
ccgcggctggacgccgtgctgaacgaggtcgcggccacttcaggcgcgctgcatctgatc
ggtctgtgttcggacgggcagatccacgcccacgtcgagcacctgagcgagctgctggcc
gccgcagccacgcaccaggtggagcgcgtcttcatccatgcgatcaccgacggccgggat
gtcgccgaccacacgggcgaggcgtatctgacacgggtggccgagttggccgccgcagcc
ggaactgggcagatcgccacagtcatcggccgcggctacgcgatggacaaggccggcgat
ctcgacctgaccgagcgtgcggtcgccctggtcgccgacgggcgcggctccccggccgac
agtgcccactcggcggtccactcaagcgaacggggcgacgagtgggtccccgcctccgtg
ctcacggaggcgggtgacgcgagggtcgccgacggggacgcggtgctgtggttcaacttc
cgcagcgaccgtatccagcagttcgcggacaggctccatgagcacctcacagccagcggc
cgcactgtgaacatggtgagcctggcccagtacgacacccgcaccgccatacccgccctc
gtgaagcgcgcggacgcctccggcggtctggccgatgagctgcaggaagccgggctgcgc
agtgtccgcatcgcggagaccgagaagttcgaacacgtcacgtactacatcaacggccgg
gacgcgaccgtacgcgacggcgaggagcatgtgcggatcacaggtgagggcaaggccgac
tacgtcgcccatccccacatgaacctcgaccgcgtcacagacgcggtagtcgaggccgcc
ggccgcgtcgatgtcgacctcgtcatcgccaatctggccaacatcgacgtggtcgggcac
acgggaaacctcgccgccaccgtcacggcctgcgaggcaaccgacgccgccgtggaccag
atcttgcaagcggcacggaacagcggccgatgggtagtggccgtgggagaccacggcaac
gccgaacgcatgaccaagcaggctccggacggcagcgtacggccctacggcggccacacg
acgaacccggtcccgctggtgatcgtcccaaaccggaccgacacgccggcacccacgctg
ccgggaacggccacgttggccgacgtggcccccaccatcctgcacctactgggacacaaa
cccggacccgccatgacaggaaggcccctactgtga

DBGET integrated database retrieval system