KEGG   Streptomyces coelicolor: SCO6833Help
Entry
SCO6833           CDS       T00085                                 

Gene name
SC3D9.01
Definition
(RefSeq) isobutyryl-CoA mutase, small subunit
  KO
K01849  methylmalonyl-CoA mutase, C-terminal domain [EC:5.4.99.2]
Organism
sco  Streptomyces coelicolor
Pathway
sco00280  Valine, leucine and isoleucine degradation
sco00630  Glyoxylate and dicarboxylate metabolism
sco00640  Propanoate metabolism
sco01100  Metabolic pathways
sco01120  Microbial metabolism in diverse environments
sco01200  Carbon metabolism
Module
sco_M00741  Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SCO6833 (SC3D9.01)
   00640 Propanoate metabolism
    SCO6833 (SC3D9.01)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCO6833 (SC3D9.01)
Enzymes [BR:sco01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.2  methylmalonyl-CoA mutase
     SCO6833 (SC3D9.01)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: B12-binding
Motif
Other DBs
NCBI-GeneID: 1102272
NCBI-ProteinID: NP_630904
Kitasato: SCO6833
UniProt: Q9L1X6
Position
7604468..7604947
Genome map
AA seq 159 aa AA seqDB search
MRQLPMRVVVAKPGLDGHDRGAKVVARALRDAGVEVIYTGLHQTPAQIVATAIQEDADGI
GLSVLSGAHMTAFTEVMKLIQLEEATNIIVFGGGIIPDDDAANLLEGGVAALFTPGTSMA
TVVDWVTNHVGGRRTGRVLAQPVPHSAQAAPAGPFQRSR
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgcggcagctaccgatgcgagtggttgtggccaaacctggcctcgacggtcacgatcgt
ggagcgaaggtcgtcgcacgagctttgcgtgatgccggagtggaagtcatctacacgggt
ctgcaccagacgccggcgcagatcgtcgccacagcaatccaggaagacgctgacggcatc
ggactatctgtgctgtccggagcgcacatgaccgcgttcacggaggttatgaagctgatc
cagctggaggaggcgacgaacattatcgtcttcggcggaggcatcattcccgatgacgat
gctgcgaacctcctcgaagggggagtcgcggccctatttacaccggggacgtcgatggcg
acggtggtcgattgggtgacgaatcatgtgggtggacggcgaaccggccgggtcttggcg
cagcctgttccccatagcgcgcaggctgctcctgctgggcccttccaacgaagccgttga

DBGET integrated database retrieval system