KEGG   Streptomyces coelicolor: SCO6834Help
Entry
SCO6834           CDS       T00085                                 

Gene name
trxB2
Definition
(RefSeq) thioredoxin reductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
sco  Streptomyces coelicolor
Pathway
sco00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SCO6834 (trxB2)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     SCO6834 (trxB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox DAO GIDA Thi4 NAD_binding_7 FAD_binding_2 Trp_halogenase FAD_oxidored NAD_binding_8 K_oxygenase HI0933_like FAD_binding_3 NAD_binding_9
Motif
Other DBs
NCBI-GeneID: 1102273
NCBI-ProteinID: NP_630905
Kitasato: SCO6834
UniProt: Q9RIS2 Q7AKE3
Position
complement(7605261..7606241)
Genome map
AA seq 326 aa AA seqDB search
MSTAKDVRDVIVIGSGPAGYTAALYTARASLNPLVFGGAIFVGGSLTTTTEVENFPGFPD
GVQGPELMENMRAQAERFGAEMVDDDIVAVDLTGDVKTVTDTAGTVHRARTVIVATGSGY
RKLGVPKEDELSGRGVSWCATCDGFFFRDRDIVVVGGGDTAMEEATFLTRFARSVTVVHR
RSALRASQVMQNRAFSEDKISLAFDSEVATLHEENGMLSGMTLRDTLTGETRELATTGLF
IAIGHDPRTELFKGQLHLDSEGYLMVESPSTRTNVPGVFGAGDVVDHTYRQAITAASSGC
AAALDAERYLAARSDTSVSAEVVAVA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgccaaggacgtgcgcgacgtcatcgtcatcggctcgggcccggccggatac
accgccgcgctatacaccgcccgcgccagcctgaaccccctcgtcttcggcggcgccata
ttcgtcggcggttcgctcacgaccacgactgaggtcgagaacttccccggcttccccgac
ggggtccagggccccgagctcatggagaacatgcgggcccaggcggagaggttcggcgcc
gagatggtcgacgacgacatcgtcgcggtcgatctgaccggtgacgtcaagaccgtcacc
gacaccgccggtaccgtccaccgtgcgaggacggtgatcgttgccacgggctccggttac
cgcaagctcggcgtgcccaaggaggacgagctgtccgggcggggcgtgtcctggtgtgcg
acctgcgacggcttcttcttccgggaccgcgacatcgtggtcgtcggcggcggcgacact
gccatggaggaggccaccttcctcacccgcttcgcccgctcggtcaccgtcgtacaccgg
cgttccgctctgcgcgcctcccaggtcatgcagaaccgcgccttctccgaggacaagatc
tctcttgccttcgacagcgaagtcgccacactccacgaggagaacggcatgctgtccggc
atgacgctgcgtgacaccctgaccggcgagactcgcgaactggccacgaccggcctgttc
atcgccatcggccatgatccgcgcaccgagctcttcaaggggcagttgcatctcgactcc
gagggttacttgatggtcgagtctccttcgacacgcacgaacgtcccgggcgtcttcggc
gccggtgacgtcgtcgaccacacctatcgccaggccattaccgcggccagctccggctgc
gccgcagcgctggacgccgagcggtatctcgcggcccggtccgacacgtccgtgtcggcc
gaggtcgtcgccgtcgcctga

DBGET integrated database retrieval system