KEGG   Streptomyces coelicolor: SCO6967Help
Entry
SCO6967           CDS       T00085                                 

Gene name
pcaF
Definition
(RefSeq) beta-ketoadipyl-CoA thiolase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
sco  Streptomyces coelicolor
Pathway
sco00071  Fatty acid degradation
sco00280  Valine, leucine and isoleucine degradation
sco00281  Geraniol degradation
sco00362  Benzoate degradation
sco00592  alpha-Linolenic acid metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01212  Fatty acid metabolism
Module
sco_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    SCO6967 (pcaF)
   00592 alpha-Linolenic acid metabolism
    SCO6967 (pcaF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCO6967 (pcaF)
  Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    SCO6967 (pcaF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SCO6967 (pcaF)
   00642 Ethylbenzene degradation
    SCO6967 (pcaF)
Enzymes [BR:sco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     SCO6967 (pcaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III Sigma70_r4
Motif
Other DBs
NCBI-GeneID: 1102405
NCBI-ProteinID: NP_631033
Kitasato: SCO6967
UniProt: Q9KZC2
Position
7733254..7734441
Genome map
AA seq 395 aa AA seqDB search
MRPVHFAAARRTPIGKLRGALSTVRPDDLAAAVLRGLVADVPALDPARVDDVYWGAANQA
GEDNRNVARMAALLAGLPETVPGATVNRLCASGLEAVTTAARTIAAGEADIVLAGGSESM
SRAPFVLPRPDEALPHRIETADTRLGWRLVNPAMKDLHGLLAMGETAEEVAERYGVPRER
QDAFALRSHRLAAEARKNGRFDDEILPVERPDGVVVDTDECVREDTSLEKLGSLKPVFRP
GGTVTAGNASPMNDGAAGLLLVSEEALNDLGLESLGRYVAGGSAGVHPDVMGIGPVPATR
KVLARAGWGIGDITEAEFNEAFAAQALACVDQLGIDPDLVNPTGGAIALGHPLGCSGARI
LTTLLHRMRRTGAGRGLATMCVGVGQGSAVLVERH
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtcccgtccacttcgcggccgcccgccgcaccccgatcggcaagctgcgcggcgcg
ctgtccaccgtgcggccggacgacctcgccgccgccgtgctccgcggcctggtcgccgac
gtgcccgcgctggacccggcccgggtcgacgacgtgtactggggcgccgccaaccaggcg
ggcgaggacaaccgcaacgtcgcccgcatggccgcgctgctcgcgggcctgcccgagacc
gtgcccggcgccaccgtcaaccggctgtgcgcctccggcctcgaagccgtcaccaccgcc
gcacgcaccatcgccgcgggcgaggccgacatcgtcctcgcgggcggctccgagtccatg
agccgcgcccccttcgtgctgccccgccccgacgaggcgctgccgcaccgcatcgagacc
gccgacacccggctcggctggcgcctggtcaacccggcgatgaaggacctgcacggcctg
ctcgccatgggggagacggccgaggaggtcgccgagcggtacggcgtcccgcgcgagcgt
caggacgcgttcgccctgcgcagccaccgcctggccgccgaggcccggaagaacggccgc
ttcgacgacgagatcctccccgtcgagcgccccgacggcgtggtcgtcgacaccgacgag
tgcgtccgcgaggacacctccctggagaagctgggcagcctcaagcccgtcttccgcccc
ggcggcacggtcaccgcgggcaacgcctccccgatgaacgacggcgccgcgggcctcctc
ctggtcagcgaggaggcgctgaacgacctcggcctggagtcgctgggccgctacgtcgcg
ggcggctcggccggcgtccaccccgacgtcatgggcatcggcccggtccccgccacccgc
aaggtgctggcccgggcgggctggggcatcggcgacatcaccgaggccgagttcaacgag
gcgttcgccgcccaggccctcgcctgcgtcgaccaactcggcatcgaccccgacctggtc
aacccgaccggcggcgccatcgcgctgggccacccgctcggctgctcgggcgcccgcatc
ctcaccaccctgctccaccgcatgcgccgtacgggggccggccgcgggctggccacgatg
tgcgtcggcgtggggcagggcagcgcggtcctcgtcgaacgtcactag

DBGET integrated database retrieval system