KEGG   Streptomyces coelicolor: SCO7000Help
Entry
SCO7000           CDS       T00085                                 

Gene name
idh, SC8F11.26c
Definition
(RefSeq) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
sco  Streptomyces coelicolor
Pathway
sco00020  Citrate cycle (TCA cycle)
sco00480  Glutathione metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
sco01210  2-Oxocarboxylic acid metabolism
sco01230  Biosynthesis of amino acids
Module
sco_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sco_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCO7000 (idh)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SCO7000 (idh)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     SCO7000 (idh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH Pr_beta_C
Motif
Other DBs
NCBI-GeneID: 1102438
NCBI-ProteinID: NP_631065
Kitasato: SCO7000
UniProt: Q9KZF3
Position
complement(7771060..7773279)
Genome map
AA seq 739 aa AA seqDB search
MTDSTIIYTHTDEAPALATYSFLPVVRAYASQAGVAVETRDISLAGRIIALFPEYLTEDQ
RIPDALAELGELAKTPAANIIKLPNISASIPQLKAAVAELQGQGYALPAYPDDPKTDEER
DIRARYDKVKGSAVNPVLREGNSDRRAPASVKNYAKTHPHRMGAWTGESKTNVATMGEND
FRSTEKSAVIAEDGTLRIELVGDDGTTTVLRESVPVKKDEVVDASVLRVAALREFLTAQV
ARAKAEGILYSVHLKATMMKVSDPIIFGHVVRAFFPKTFAQYGDVLAKAGLTPNDGLGGI
YKGLESLPEGAEIKASFDAELAEGPELAMVDSDKGITNLHVPSDVIIDASMPAMIRTSGH
MWGADGGEHDALAVIPDSSYAGVYQAVIEDCRANGAYDPSTMGSVPNVGLMAQKAEEYGS
HDKTFEIPTTGTVRLVDAAGNAVLEQTVSAGDIFRACQTKDAPIRDWVKLAVTRARATGD
PAVFWLDEGRAHDANLIAKVKQYLSEHDTEGLDIRILDPVEATKLSVERIRRGENTISVT
GNVLRDYLTDLFPILELGTSAKMLSVVPLMAGGGLFETGAGGSAPKHVQQLVKEDYLRWD
SLGEFFALVPSLEKYAEATGNGKAKVLADTLDRATATFLNEDKSPTRRVGGIDNRGSHFY
LSLYWAQELAKQTDDADLAKAFAPLAETLTASEQKIVEELNAVQGKPAEIGGYYQPDPAK
AAKIMRPSTTWNEALASLA
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
gtgactgactcgaccatcatctatacacacactgacgaggccccggccctggcgacgtat
tcgttcctgccggtggtccgggcgtacgcctcgcaggcgggtgtcgcggtcgagacccgc
gacatctcgctggccggccgcatcatcgccctgttcccggagtacctcaccgaggaccag
cgcatcccggacgccctcgcggagctgggcgagctggccaagacgcccgccgccaacatc
atcaagctgccgaacatctcggcgtccatcccgcagctcaaggccgccgtcgccgagttg
cagggccagggctacgcgctgccggcctacccggacgacccgaagaccgacgaggagcgc
gacatccgcgcccgctacgacaaggtcaagggctccgcggtcaacccggtcctgcgcgag
ggcaactccgaccggcgcgccccggcgtcggtgaagaactacgccaagacccacccgcac
cgcatgggcgcctggaccggcgagtccaagaccaacgtggcgaccatgggcgagaacgac
ttccgctccaccgagaagtccgcggtgatcgccgaggacggcaccctgcggatcgagctg
gtcggcgacgacggcaccaccaccgtgctgcgcgagtcggtgccggtgaagaaggacgag
gtcgtcgacgcctccgtgctgcgcgtcgccgccctgcgcgagttcctcaccgcgcaggtc
gcccgcgccaaggccgagggcatcctctactcggtgcacctgaaggccacgatgatgaag
gtctccgacccgatcatcttcggccacgtggtccgcgccttcttcccgaagaccttcgcc
cagtacggcgacgtgctcgccaaggccggcctcaccccgaacgacggcctgggcggcatc
tacaagggcctggagtccctgcccgagggcgccgagatcaaggcgtccttcgacgccgag
ctggccgagggcccggagctggccatggtcgactccgacaagggcatcaccaacctgcac
gtgccctcggacgtcatcatcgacgcgtccatgccggccatgatccgcacctccggtcac
atgtggggcgcggacggcggcgagcacgacgccctcgccgtgatcccggactcctcgtac
gccggtgtgtaccaggccgtcatcgaggactgccgcgccaacggcgcctacgacccctcc
accatgggttcggtcccgaacgtcggcctcatggcgcagaaggccgaggagtacggcagc
cacgacaagaccttcgagatccccaccacgggcaccgtccgcctggtcgacgccgcgggc
aacgcggtgctggagcagacggtctccgccggtgacatcttccgcgcctgccagaccaag
gacgcgccgatccgcgactgggtgaagctggccgtcacccgcgcccgcgccaccggcgac
ccggccgtcttctggctggacgagggccgcgcccacgacgccaacctgatcgccaaggtc
aagcagtacctgtcggagcacgacaccgagggcctggacatccggatcctcgacccggtc
gaggcgaccaagctgtcggtggagcgcatccgccgcggcgagaacaccatctcggtcacc
ggcaacgtgctgcgcgactacctgaccgacctgttcccgatcctggagctgggcaccagc
gccaagatgctgtcggtcgtcccgctgatggcgggcggcggcctcttcgagaccggtgcc
ggcggttcggccccgaagcacgtgcagcagctggtcaaggaggactacctgcgctgggac
tcgctcggtgagttcttcgccctggtgccgtccctggagaagtacgccgaggccacgggc
aacggcaaggccaaggttctcgccgacaccctcgaccgcgccacggcgacgttcctcaac
gaggacaagtccccgacccgccgcgtcggcggcatcgacaaccgcggcagccacttctac
ctgtccctgtactgggcgcaggagctggcgaagcagaccgacgacgcggacctggccaag
gccttcgccccgctcgccgagacgctcaccgcgagcgagcagaagatcgtcgaggagctg
aacgccgtccagggcaagccggccgagatcggcggctactaccagcccgacccggccaag
gccgccaagatcatgcgcccgtcgaccacctggaacgaggcgctggcgtccctcgcctga

DBGET integrated database retrieval system