KEGG   Streptomyces coelicolor: SCO7005Help
Entry
SCO7005           CDS       T00085                                 

Gene name
SC8F11.31
Definition
(RefSeq) oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sco  Streptomyces coelicolor
Pathway
sco00564  Glycerophospholipid metabolism
sco01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SCO7005 (SC8F11.31)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SCO7005 (SC8F11.31)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD Pyr_redox_2 NAD_binding_8 Lycopene_cycl Thi4 3HCDH_N Pyr_redox NAD_binding_9 Semialdhyde_dh FAD_binding_3 FAD_binding_2 GMC_oxred_N ApbA AlaDh_PNT_C Mqo HI0933_like
Motif
Other DBs
NCBI-GeneID: 1102443
NCBI-ProteinID: NP_631070
Kitasato: SCO7005
UniProt: Q9KZE8
Position
7778881..7780284
Genome map
AA seq 467 aa AA seqDB search
MSVTRSGAPPVEPYDVAIVGAGVVGCAIARRLAHHPGLRVALVEAQDDVGQGTSKANTAI
LHTGFDAVPGSLEARLVREGSRELAAYAAESGIPVERVGALLVAWDEEQLAALPRLAEKA
RRNEYHDTRVLGAADLYAREPRLGPGALGALHVPGESIICSWTTTLAYATQAVRAGVDLY
LEAPITHAGHADGVHRLDTPRGPLHARRLVNAAGLHADTLDRSLGHDDFTVTPRRGQLVV
HDTFARALVRHILLPVPTALGKGVLVAPTVYGNVLLGPTAEDLDDKGDTGSTAEGLRRLR
EQGRRILPALLEEEVTAVYAGLRAATGHDDYRIAAHPGQGYVTVGGIRSTGLTASLAIAA
HVTGLLADTGLDLGARRPLEPVRMPNLGEAFPRPHQRPDLVAADPEYGTLVCHCERVSRG
EIRDALAGPVPPRSLDGLRRRTRARAGRCQGFYCGAAVRALFEEAQG
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtcacccggtcgggggcgccgcccgtcgagccgtacgacgtggcgatcgtcggc
gccggggtcgtcgggtgtgcgatcgcccggcggctcgcacaccacccggggctgcgcgtc
gccctcgtcgaggcgcaggacgacgtggggcagggcacctccaaggcgaacaccgccatc
ctgcacaccgggttcgacgccgtgcccggctcgctggaggcccggctcgtgcgcgagggc
tcccgcgaactcgccgcgtacgcggccgagtcgggcatccccgtcgaacgcgtcggcgcc
ctgctcgtcgcctgggacgaggagcagctcgcggcgctgccccgcctcgccgagaaggcc
cgccgcaacgagtaccacgacacccgcgtcctcggcgccgccgacctctacgcccgcgag
ccccgcctcggccccggcgcgctcggcgccctgcacgtacccggcgagagcatcatctgc
tcgtggacgacgaccctcgcatacgccacccaggcggtccgtgccggagtcgacctgtac
ctcgaagcgcccatcacgcacgccggtcacgcggacggcgtccaccggctcgacaccccg
cgcggccccctgcacgcccggcggctcgtcaacgcggccggactgcacgccgacaccctc
gaccggagcctgggccacgacgacttcaccgtcaccccgcgccggggacagctcgtcgtc
cacgacacgttcgcccgcgccctggtccgccacatcctgctgcccgtccccaccgccctc
ggcaaaggcgtcctggtcgcccccaccgtctacggcaacgtcctgctcggccccaccgcg
gaggacctggacgacaagggcgacaccggctcgacggccgaggggctgcggcgcctgcgc
gaacagggccgccgtatcctccccgccctgctggaggaggaggtcaccgccgtctacgcg
ggcctgcgcgccgccaccgggcacgacgactaccggatcgccgcccaccccggccagggc
tacgtcaccgtcggcggcatccgttccaccggcctcaccgcctccctcgccatcgccgcg
cacgtcaccggcctcctcgcggacaccggcctcgacctcggcgcccggcgcccgctcgaa
ccggtccgcatgccgaacctcggcgaggccttcccccgtccccaccagcgccccgacctg
gtggccgccgacccggagtacggcaccctggtctgccactgcgaacgcgtctcccgcggc
gagatccgcgacgccctcgccgggccggtcccaccccggtccctggacggactgcgccgc
cgcacccgggcccgggcgggccgctgccagggcttctactgcggggcggcggtacgggcg
ttgttcgaggaggcgcaagggtga

DBGET integrated database retrieval system