KEGG   Streptomyces coelicolor: SCO7031Help
Entry
SCO7031           CDS       T00085                                 

Gene name
SC1H10.20
Definition
(RefSeq) beta-D-xylosidase
  KO
K17641  beta-xylosidase
Organism
sco  Streptomyces coelicolor
Brite
KEGG Orthology (KO) [BR:sco00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99981 Carbohydrate metabolism
    SCO7031 (SC1H10.20)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C Fn3-like
Motif
Other DBs
NCBI-GeneID: 1102469
NCBI-ProteinID: NP_631095
Kitasato: SCO7031
UniProt: Q9L024
Position
7817054..7819447
Genome map
AA seq 797 aa AA seqDB search
MTADVAVETTPEIPLWNDPNHPVATRVDALVAAMTLEEKIAQLYGVWVGASDQGGEVAPH
QHDMEEAVDLDALVPAGLGQLTRPFGTVPVDPALGALSLMRTQARITSAGRFGIPAVAHE
ECLAGFAAWGATAYPVPLSWGATFDPDAVRRMAAAIGRDMRSVGIHQGLAPVLDVVRDAR
WGRVEETIGEDPYLVGTIGTAYVQGLESAGIVATLKHFVGYSASRAGRNLAPSSVGTRER
ADVLLPPFEMAVREGGSRSVMSAYTDIDGVPAAADEALLTGLLRDTWGFEGTVVADYFGI
AFLKTLHGITADWADAAGAALKAGLDVELPTVKTFGTPLVDAVTDGRVPEALIDRALRRV
LGQKAELGLLDPDWSPVPPALDGVDLSHPEALRGRIDLDRPENRELAREIAEKAVVLLTN
DGTLPLARPRRIALIGPNAAEATAVLGCYSFPRHVGVQHPEVPVGLDLPTLYDTLTAEFP
DADITLARGTGVDDGEVSGIGEAVDAARAADVVVAVLGDRAGLFGRGTSGEGCDAESLTL
PGAQQRLLDALLDSGTPVVTVLLAGRPYALGRAIAESAAIVQSFFPGEEGTAALAGVLSG
RTSPTGRLPVSVPGSAGAQPTTYLGARLAQASEVSNIDPTPAFGFGHGLTYTTFAWSDLV
AHTKEAPTDGAFSLELTVRNTGERHGTEVVQLYLHDPVASVVQPVQRLIGYTRVPLAPGE
ARRVRVEVPADLASFTGRDGRRIVEPGDLELRFAASSTEPRLTATVALTGPERRVDHTRR
LHAVFAQETVEGAVEGA
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
gtgactgccgacgtggctgtagagaccacccccgaaatccccctctggaacgaccccaac
caccccgtcgccaccagggtcgacgcgctcgtcgccgcgatgaccctggaggagaagatc
gcccagctgtacggagtgtgggtgggtgcctccgaccagggcggcgaagtcgccccccat
cagcacgacatggaggaggccgtcgacctcgacgcgctcgtgcccgccgggctcggtcag
ctcacccggcccttcggcaccgtcccggtcgaccccgcgctcggcgcgctctcgctcatg
cgcacgcaggcccgcatcacctcggccggccgcttcggcatccccgccgtcgcccatgag
gagtgcctggccggcttcgccgcctggggcgccacggcctaccccgtcccgctgtcctgg
ggcgccaccttcgacccggacgcggtacgccggatggccgccgccatcggccgcgacatg
cggtccgtcggcatccaccagggcctcgcccccgtgctcgacgtggtccgcgacgcccgc
tggggcagggtggaggagaccatcggcgaggacccctacctcgtcggcaccatcggtacc
gcgtacgtgcagggcctggagtccgccggcatcgtcgccaccctcaagcacttcgtcggc
tactccgcctcccgcgccggccgcaacctcgctccctcctccgtgggcacccgcgagcgg
gccgacgtcctgctcccgccgttcgagatggccgtccgcgagggcggctcccgctccgtg
atgtccgcctacaccgacatcgacggcgtgcccgcagcggccgacgaggcgctgctgacc
gggctgctgcgcgacacctggggcttcgagggaacggtcgtcgccgactacttcggcatc
gccttcctcaagacgctgcacggcatcaccgccgactgggccgacgccgccggagccgcg
ctgaaggcgggcctcgacgtcgagctgcccaccgtcaagaccttcgggaccccgctcgtc
gatgcggtcaccgacggccgggtgcccgaggccctcatcgaccgggcgctgcgccgcgtc
ctgggacagaaggcggagctcggactgctcgacccggactggagcccggtcccgcccgcg
ctcgacggagtggacctctcgcacccggaggcgctgcgcggccggatcgacctggaccgg
cccgagaaccgggaactggcccgcgagatcgccgagaaggcggtcgtcctgctcaccaac
gacggcaccctgccgctcgcccggccccgccgcatcgcactgatcggccccaacgccgcc
gaggccaccgccgtactcggctgctactccttcccgcgccacgtcggggtgcagcacccg
gaggtcccggtcggcctcgacctgcccaccctgtacgacaccctgaccgccgagttcccc
gacgccgacatcaccctcgcccgcggcaccggcgtcgacgacggcgaggtgtccggcatc
ggcgaggcggtggacgcggcccgggccgcggacgtcgtcgtcgccgtactgggcgaccgc
gcgggcctgttcggccggggcaccagcggcgagggctgcgacgccgagtccctcaccctg
cccggcgcccagcagcggctcctcgacgcgctgctcgactccggcaccccggtggtcacc
gtgctgctcgccggacggccctacgcactcggccgcgccatcgccgagtccgccgcgatc
gtgcagtcgttcttccccggtgaggagggcaccgcggcgctcgccggcgtgctcagcgga
cgcaccagccccaccggcaggctgcccgtcagcgtgcccggcagcgcgggtgcccagccg
accacctacctcggggcgcggctcgcccaggccagcgaggtgtccaacatcgacccgaca
ccggccttcggcttcgggcacgggctcacgtacaccacgttcgcctggagcgacctggtg
gcgcacaccaaggaggcgccgaccgacggtgcgttctcgctggagctgaccgtccgcaac
accggcgaacggcacggcaccgaggtggtgcagctctacctgcacgacccggtcgcctcc
gtcgtccagccggtgcagcgcctcatcggctacacgcgggtgccgctggcccccggcgag
gcccgccgggtgcgcgtcgaggtcccagccgacctcgcctccttcaccggccgcgacggc
cgccggatcgtcgaaccgggcgacctggagctgcggttcgccgcgtccagcaccgagccg
cggctgacggcgacggtcgcgctcaccggaccggaacggcgggtcgaccacacccggcgg
ctgcacgccgtcttcgcgcaggagaccgtggaaggcgcggtcgagggcgcctga

DBGET integrated database retrieval system