KEGG   Streptomyces coelicolor: SCO7036Help
Entry
SCO7036           CDS       T00085                                 

Gene name
argG, SC4G1.02
Definition
(RefSeq) argininosuccinate synthase
  KO
K01940  argininosuccinate synthase [EC:6.3.4.5]
Organism
sco  Streptomyces coelicolor
Pathway
sco00220  Arginine biosynthesis
sco00250  Alanine, aspartate and glutamate metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
sco01230  Biosynthesis of amino acids
Module
sco_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCO7036 (argG)
   00220 Arginine biosynthesis
    SCO7036 (argG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sco04147]
    SCO7036 (argG)
Enzymes [BR:sco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.5  argininosuccinate synthase
     SCO7036 (argG)
Exosome [BR:sco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SCO7036 (argG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginosuc_synth QueC Asn_synthase
Motif
Other DBs
NCBI-GeneID: 1102474
NCBI-ProteinID: NP_631098
Kitasato: SCO7036
UniProt: P24532
Position
7824771..7826216
Genome map
AA seq 481 aa AA seqDB search
MSKVLTSLPTGERVGIAFSGGLDTSVAVAWMRDKGAVPCTYTADIGQYDEPDIASVPDRA
KTYGAEVARLVDCRAALVEEGLAALTCGAFHIRSGGRAYFNTTPLGRAVTGTLLVRAMLE
DDVQIWGDGSTFKGNDIERFYRYGLLANPQLRIYKPWLDADFVTELGGRKEMSEWLVAHD
LPYRDSTEKAYSTDANIWGATHEAKTLEHLDTGVETVEPIMGVRFWDPSVEIAPEDVTIG
FDQGRPVTINGKEFASAVDLVMEANAVGGRHGMGMSDQIENRIIEAKSRGIYEAPGMALL
HAAYERLVNAIHNEDTLAQYHTEGRRLGRLMYEGRWLDPQSLMIRESLQRWVGSAVTGEV
TLRLRRGEDYSILDTTGPAFSYHPDKLSMERTEDSAFGPVDRIGQLTMRNLDIADSRAKL
EQYAGLGLIGTANPAIGAAQAAATGLIGAMPEGGAQAIASRGEVSADDELLDRAAMESGT
D
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaggtcctcacctccctccccaccggcgagcgcgtcggtatcgccttctcgggc
ggcctcgacacctcggtcgcggtcgcgtggatgcgtgacaagggcgccgtcccctgcacg
tacaccgccgacatcggccagtacgacgagcccgacatcgcctcggtgcccgaccgtgcc
aagacgtacggcgccgaggtcgcgcgcctggtcgactgccgcgcggcgctggtcgaggag
gggctggccgcgctcacctgcggggcgttccacatccgctcgggcgggcgggcgtacttc
aacaccacgccgctgggccgcgccgtcacgggcaccctcctcgtccgggccatgctcgag
gacgacgtccagatctggggcgacggctccacgttcaagggcaacgacatcgagcggttc
taccggtacggcctgctcgccaacccgcagctgaggatctacaagccctggctggacgcg
gacttcgtgacggagctcggcgggcgcaaggagatgtcggagtggctggtcgcccacgac
cttccctaccgggactccacggagaaggcgtactccaccgacgccaacatctggggcgcc
actcacgaggccaagacgctggagcacctcgacaccggcgtggagaccgtggagcccatc
atgggcgtgcggttctgggacccgtcggtcgagatcgcgcccgaggacgtgaccatcggc
ttcgaccagggccgcccggtgacgatcaacggcaaggagttcgcctccgcggtcgacctg
gtcatggaggccaacgccgtcggcggccggcacggcatgggcatgtccgaccagatcgag
aaccggatcatcgaggccaagagccgcggcatctacgaggcgcccggcatggccctgctg
cacgccgcctacgagcgcctggtcaacgccatccacaacgaggacaccctcgcccagtac
cacaccgaggggcggcgcctgggccggctgatgtacgagggccgctggctggacccgcag
tccctgatgatccgcgagtcgctgcagcgctgggtcggctccgcggtcaccggcgaggtc
accctccggctgcggcgcggcgaggactactcgatcctcgacaccaccggcccggccttc
agctaccacccggacaagctctccatggagcgcaccgaggactccgcgttcggcccggtg
gaccggatcggccagctgaccatgcgcaacctggacatcgccgactcccgcgccaagctg
gagcagtacgccggtctcggtctcatcggcaccgccaaccccgccatcggcgccgcccag
gccgccgcgaccgggctgatcggcgccatgccggagggtggcgcgcaggccatcgcctcc
cgcggcgaggtctccgccgacgacgagctgctggaccgcgccgcgatggagtccggcacg
gactga

DBGET integrated database retrieval system