KEGG   Streptomyces coelicolor: SCO7049Help
Entry
SCO7049           CDS       T00085                                 

Gene name
SC4G1.15
Definition
(RefSeq) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
sco  Streptomyces coelicolor
Pathway
sco00220  Arginine biosynthesis
sco00250  Alanine, aspartate and glutamate metabolism
sco00471  D-Glutamine and D-glutamate metabolism
sco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCO7049 (SC4G1.15)
   00220 Arginine biosynthesis
    SCO7049 (SC4G1.15)
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SCO7049 (SC4G1.15)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     SCO7049 (SC4G1.15)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-GeneID: 1102487
NCBI-ProteinID: NP_631111
Kitasato: SCO7049
UniProt: P57755
Position
7839207..7840130
Genome map
AA seq 307 aa AA seqDB search
MSTPTTFRPVLERIAEEIERTPGSGRPADYIPALAARDPRRFGMAVAELDGTVYGVGDWR
EPFSAQSLTKVFTLALDLAREGDALWEHVGREPSGNPFNSLVQLEYENGIPRNPFINAGA
LVVTDRLHTRTGDAAGELLAFLRAESGNPDLGHDEEVAASEAAHGDRNAALAHFMASYGN
IDNPVPVLLDQYFRQCSVAASCADLALATGFLARHGIRADGTRLLSRSRAKQINAVMLTC
GTYDAAGDFAHRVGLPGKSGVGGGIIAVVPGHCTLCVWGPGLDERGNSVAGVAALDRFTT
LTGLSVF
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaccgacgaccttccggccggtcctggagcgcatcgccgaggagatcgagcgg
accccgggcagcggccggcccgccgactacatccccgccctcgccgcccgcgacccgcgc
cgcttcggcatggccgtcgccgagctggacggcacggtctacggggtgggggactggcgg
gagccgttctccgcgcagtccctcaccaaggtcttcaccctcgccctcgacctggccagg
gagggcgacgccctgtgggagcacgtgggccgcgagccgtccggcaacccgttcaactcc
ctggtgcagctggagtacgagaacggcatcccgcgcaacccgttcatcaacgcgggcgcc
ctcgtcgtcaccgaccggctgcacacccgcaccggcgacgcggccggcgaactgctcgcc
ttcctgcgcgccgagagcggcaacccggacctcggtcacgacgaggaggtcgccgcctcc
gaggccgcgcacggcgaccggaatgccgcgctggcgcacttcatggcgtcctacggcaac
atcgacaaccccgtcccggtgctcctggaccagtacttccgccagtgctccgtcgccgcg
tcctgcgccgacctggccctggccaccggcttcctggcccggcacggcatccgtgcggac
ggcacccggctgctcagccgcagccgggccaagcagatcaacgcggtgatgctgacctgc
gggacctacgacgcggccggcgacttcgcgcaccgggtgggtctgccgggcaagagcggg
gtcggcggcggcatcatcgcggtggtgccgggacactgcacgctgtgcgtgtggggcccc
ggcctggacgagcggggcaactcggtggccggggtggcggccctggaccgcttcacgacg
ctcacggggctgtcggtgttctga

DBGET integrated database retrieval system