KEGG   Streptomyces coelicolor: SCO7120Help
Entry
SCO7120           CDS       T00085                                 

Gene name
qrcB2, SC4B10.21
Definition
(RefSeq) ubiquinol-cytochrome C reductase cytochrome B subunit
  KO
K03891  ubiquinol-cytochrome c reductase cytochrome b subunit
Organism
sco  Streptomyces coelicolor
Pathway
sco00190  Oxidative phosphorylation
sco01100  Metabolic pathways
Module
sco_M00151  Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SCO7120 (qrcB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_B_N_2 Cytochrome_B DUF4405
Motif
Other DBs
NCBI-GeneID: 1102558
NCBI-ProteinID: NP_631181
Kitasato: SCO7120
UniProt: Q9FC66
Position
7910084..7911703
Genome map
AA seq 539 aa AA seqDB search
MGHDSRPVEPEQERTGDRLARWADSRLGRRPVARSVRRLVFPDHWSLMLGEIALYSFVIL
LITGVYLSLYFHPSSELVVYQGDYAPLRGQLVSEAFDSTLHISFDVRGGLLVRQAHHWAA
LVFVAALLAHMLRVFFTGAFRKPRELNWVLGFGLLVLAMFGGLTGYDLPGDLLSGTGLQV
VNGTILSIPVVGTYLSFFLFGGEFPGDDLIARFNTLHVLVIPVLMVVLIAGYAVLALRHR
PAQYPGPGRTRDNVVGLPAKVYAVKAAGYFFFVAGVIFFMAAVAEINPVWDYGPFRPDQV
SAGSQPDWYMGVADGLLRVMPGWEIDFWGHTLALDNLLPLLAGTLLFLAMGAYPFLEAWV
TDDDSEHHLLDRPRNRPVRTALGVAWLSVYAVALIGAANDIIATRLHMSVNDVTWAVRVG
LFVVPVLAFVVTKRVALALQRKDRDLVLHGRETGVIKRLPHGEYVEVHEPLDPARLHTLT
SHEQHRPLDAVPPRDGDGAVVRGTQRLRTGLSGFLYGPGTQIPKPTATEHEEITGRHGS
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgggccacgacagccggccggtggagccggagcaggagcgcacgggggacaggctcgcc
cgatgggcggacagccggctgggccgccgccccgtcgcgcgctccgtccggcgcctggtc
ttccccgaccactggtcgttgatgctcggtgagatcgcgctctacagtttcgtgatcctg
ctgatcaccggtgtctatctgagcctctacttccacccttcctccgaactcgtggtctac
cagggcgactacgcccccttgcgcgggcagttggtgtccgaggccttcgactcgaccctg
cacatctccttcgacgtacgcggcggcctgctcgtccgccaggcccaccactgggcggcc
ctggtcttcgtcgccgccctcctcgcccacatgctgcgggtcttcttcaccggcgcgttc
cgcaagccgcgggagctgaactgggtgctggggttcggactgctcgtcctggcgatgttc
gggggtctgaccggctacgacctgccgggcgacctgctgtccggcaccggcctccaggtc
gtgaacggcacgatcctgtcgatccccgtcgtcgggacctatctgtcgttcttcctcttc
ggcggtgagttccccggcgacgacctgatcgcccgcttcaacaccctgcacgtcctggtc
atccccgtgctcatggtcgtcctcatcgccggctacgcggtcctggccctgcgccaccgg
cccgcgcagtaccccggacccggccgtacccgcgacaacgtcgtcggtcttccggccaag
gtgtacgccgtgaaggccgcgggctacttcttcttcgtggccggcgtgatcttcttcatg
gccgccgtcgccgagatcaaccccgtctgggactacggccccttccgtcccgaccaggtc
tccgccgggtcacagcccgactggtacatgggcgtcgccgacggactgctgcgcgtcatg
cccggctgggagatcgacttctggggccacaccctggcgctggacaacctgctgccgctg
ctggccgggacgctgctcttcctggccatgggggcctatccgttcctggaggcctgggtg
acggacgacgacagcgagcaccacctgctggaccgtccccgcaaccgcccggtacgcacc
gccctcggcgtggcctggctcagtgtctacgcggtggccctgatcggtgccgccaacgac
atcatcgccacccgcctgcacatgtccgtcaacgacgtgacctgggccgtccgcgtcggc
ctcttcgtcgtcccggtcctggccttcgtcgtcaccaagcgcgtggcgctggcactgcag
cgcaaggaccgcgacctggtgctgcacggccgcgagaccggcgtcatcaaacgcctgccg
cacggcgagtacgtcgaggtccacgagcccctcgacccggcccgactgcacacgctgacc
tcgcacgagcagcaccggcccctggacgccgtacccccgcgcgacggggacggcgccgtg
gtccgcggcacacagcgcctgcgcaccgggctcagcggcttcctctacggccccggcacg
cagattcccaagcccacggcgaccgagcacgaagagatcaccggtcggcacgggtcctga

DBGET integrated database retrieval system