KEGG   Streptomyces coelicolor: SCO7123Help
Entry
SCO7123           CDS       T00085                                 

Gene name
SC4B10.24c
Definition
(RefSeq) acyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sco  Streptomyces coelicolor
Pathway
sco00020  Citrate cycle (TCA cycle)
sco00310  Lysine degradation
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
Module
sco_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sco_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCO7123 (SC4B10.24c)
  Amino acid metabolism
   00310 Lysine degradation
    SCO7123 (SC4B10.24c)
Enzymes [BR:sco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SCO7123 (SC4B10.24c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-GeneID: 1102561
NCBI-ProteinID: NP_631184
Kitasato: SCO7123
UniProt: Q9FC63
Position
complement(7913374..7914627)
Genome map
AA seq 417 aa AA seqDB search
MTVSVTLPALGESVTEGTVTRWLKQVGDRVEADEPLLEVSTDKVDTEIPSPAAGVLLEIL
AAEDETVEVGAGLGIIGAPDTAPAAPAAPAAPAPAPAPTPTPTPTPTPTASAPAPTPAPA
PAPAPAPAPAEPFVPPAASAVPAPPAPAPAPTTPQAPAPAPAPVRAAPAEDASSLRGRTV
AMTRIRRAIGNNLKKALLEQAQLTSTVEADVTRLMRLRNRAKDGFLAREGLKLSPMPFFV
KAAAQALKAHPVVNARINEDEGTITYFDSENIGIAVDTEAGLMTPVVKAAGDLTVAGLAR
AVHDLADRARGGHLTPDDVSGATFTISNTGSRGALFDTVIVPPNQAAILGVGATVRRPGV
VRVGDEEVIGVRDLVHLSLSYDHRLVDGADAARYLTAVKALLESAAFEDDLYPDAAA
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtttccgtgaccctgccggctctcggcgagtccgtcaccgagggcaccgtgacc
cgctggctgaagcaggtcggtgaccgcgtcgaggccgacgagcccttgctggaggtgtcg
accgacaaggtggacaccgagattccctcccctgccgcgggcgtcctgctggagatcctc
gccgccgaggacgagaccgtcgaggtcggtgccggcctcggcatcatcggcgcaccggac
acggccccggcggccccagcggccccggccgcaccggcacccgcacccgcacccacaccc
acacccacacccacacccacacccacagcatcggcgccggctcccactccggctccggct
ccggctccggctccggctccggctccggccgagcctttcgtgccgcctgccgcgtccgcc
gttccggctccccccgcgccggcgccggcacccacgactccgcaggcaccggcgcccgcg
cccgcgccggtgcgcgccgccccggcggaggacgcctcctcgctccgcggccgcacggtc
gcgatgacccgtatccgccgggccatcggcaacaacctcaagaaggcgctgttggagcag
gcgcagctcacctcgacggtcgaggccgacgtcacccggctcatgcgcctgcggaaccgg
gccaaggacgggttcctggcccgggagggcctcaagctctcccccatgcccttcttcgtc
aaggcagccgcccaggcgctgaaggcgcatccggtggtcaacgctcggatcaacgaggac
gaggggaccatcacctacttcgacagcgagaacatcgggatcgcggtcgacacggaggcc
ggtctgatgaccccggtcgtcaaggcggccggtgacctcaccgtcgccgggctcgcccgg
gccgtccacgacctcgccgaccgggcccgcggtggtcacctgaccccggacgacgtgtcg
ggcgcgaccttcacgatctccaacaccggttcgcgcggcgccctgttcgacaccgtcatc
gtgccgccgaaccaggccgcgatcctcggcgtgggcgccacggtcaggaggccgggggtc
gtgcgcgtcggtgacgaggaggtcatcggcgtccgggacctggtgcacctgtcgctgtcg
tacgaccaccggctggtggacggcgcggacgcggcccgctacctgacggcggtcaaggcg
ctcctggagtcggcggcgttcgaggacgacctgtaccccgacgccgctgcgtga

DBGET integrated database retrieval system