KEGG   Streptomyces coelicolor: SCO7124Help
Entry
SCO7124           CDS       T00085                                 

Gene name
aceE
Definition
(RefSeq) pyruvate dehydrogenase subunit E1
  KO
K00163  pyruvate dehydrogenase E1 component [EC:1.2.4.1]
Organism
sco  Streptomyces coelicolor
Pathway
sco00010  Glycolysis / Gluconeogenesis
sco00020  Citrate cycle (TCA cycle)
sco00620  Pyruvate metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
Module
sco_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO7124 (aceE)
   00020 Citrate cycle (TCA cycle)
    SCO7124 (aceE)
   00620 Pyruvate metabolism
    SCO7124 (aceE)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     SCO7124 (aceE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDH_E1_M Transketolase_N Transketolase_C PaaX DUF3135
Motif
Other DBs
NCBI-GeneID: 1102562
NCBI-ProteinID: NP_631185
Kitasato: SCO7124
UniProt: Q9FC62
Position
complement(7914737..7917424)
Genome map
AA seq 895 aa AA seqDB search
MSDPSRPTENPVISELDQLPDRDREETAEWRASLDAVVRNAGPERAVYLMRRVHEFAAST
GMSLPGLLHSDYINTVPAAAQPEFDGDLEMESRITALNRWNAAAMVTRGARLGLGGHIST
YASAAWLYEIGFHHFFRGKDADGSGDQLFVQGHASPGIYARVFLEGRLSESQLDSFRREA
GGHGLPSYPHPRRLPWLWEFPTVSMGLGPLSAVYQARFNRYLHARGIKDTSASRVWAFLG
DGEMDEPESTAALTLASRENLDNLTFVINCNLQRLDGPVRSNSKIVQELEARFRGAGWNV
VKTLWGEAWDPLLAQDTTGDLVRRLGEVPDAQMQTLAARDAAYIRKHFFTGDALSALSAS
LSDARVVELFENSRGGHEPLKVYAAYRAAVEHRGAPTVVLAQTVKGHTLGPAFESRNANH
QMKKLTMEQFRAMRDLLELPIPDSALAGDQVPFWHPGQDSPEVRYLHERRAALGGPAPVR
RVVAKPLPEPPAKPFEDLEKGSGHQEMATTMALVRLVKDLMRDPRSGARWVPIVPDEART
FGMESMFPTAGIYSPQGQTYDPVDADQLLHYLESTTGQLLIEGITEAGSVAEFAAAATSY
ATHGEPMIPFYIFYAMFGFQRTGDQFWALGDQMGRGFVVGGTAGRTTMTGEGLQHGDGHS
HLLAATNPAAVSYDPAFAYEIAVIVRDGLRRMYGERPENVFYYLTVYNEPKHQPAMPPVP
GIEEGIVRGIYRFRPAEAPAAGPRLQLLASGTAIHWVLRAQELLASDWGVHADVWSVTSW
TELRRDAMRADDARTRGEERTPFVTRALSGAPGPVLAVSDWMRQVPDQISQWVEQDYYSL
GTDGFGLSDTREDVRRYFRVDAESIVVTALDRLARAGQVPPETVARARAQYGLGR
NT seq 2688 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatccctcccggccgaccgagaaccctgtgatcagtgagctggaccaactgccc
gaccgcgaccgcgaggagaccgccgagtggcgggcctccctcgacgccgtcgtgcgcaac
gcggggccggaacgggcggtgtacctgatgcggcgggtgcacgagttcgccgcgagtacg
ggcatgtccctgccggggctgctgcactccgactacatcaacaccgtccccgccgccgcg
cagccggagttcgacggtgacctggagatggagtccaggatcaccgcgctcaaccggtgg
aacgcggcggcgatggtcacccgcggcgcgcgcctcggactgggcggtcacatctccacc
tacgcgtcggcggcctggctctacgagatcggcttccaccacttcttccggggcaaggac
gccgacggctccggcgaccagctcttcgtccagggacacgcctcccccggcatctacgcc
cgggtcttcctggaggggcggctgagcgagagccagctggactccttccgccgggaggcc
ggcggtcatggactgccgtcctatccgcacccccggcggctgccgtggctgtgggagttc
ccgacggtctccatgggactgggccccctcagcgccgtctaccaggcccgcttcaaccgc
tatctgcacgcccgcggcatcaaggacacctccgcctcacgggtgtgggcgttcctgggc
gacggggagatggacgagccggagtcgacggccgccctgaccctggcctcccgcgagaac
ctggacaacctcaccttcgtcatcaactgcaacctccagcgcctggacggcccggtacgg
tccaactcgaagatcgtccaggaactggaggcacggttccggggcgcgggctggaacgtg
gtcaagacgctctggggcgaggcctgggacccgctgctggcgcaggacaccaccggcgac
ctggtacggcgcctgggcgaggtgcccgacgcccagatgcagacgctcgccgcgcgggac
gcggcctacatacgcaagcacttcttcacgggtgacgccctgtcggcgctctccgcctcc
ctgagcgacgcgcgggtggtcgagctgttcgagaactcgcggggcggacacgagccgttg
aaggtgtacgccgcctaccgggccgccgtcgagcaccggggcgccccgacggtggtcctc
gcccagacggtgaagggccacacgctgggcccggcgttcgagtcgcgcaacgccaaccac
cagatgaagaagctcacgatggagcagttccgtgccatgcgcgacctgctggagctgccc
atccccgacagcgcgctggccggcgaccaggtgccgttctggcacccagggcaggactcg
cccgaggtgcgttacctgcacgaacgccgggccgcgctgggcgggcccgcgcccgtgcgc
cgggtggtcgccaagccgctgccggaaccgcccgccaagcccttcgaggacctggagaag
gggtccggccaccaggagatggccaccacgatggcactggtccggctggtcaaggacctc
atgcgcgacccgcgcagcggggcccgctgggtgccgatcgtccccgacgaggcccgcacc
ttcggcatggagtcgatgttccccaccgccggcatctactcgccgcagggccagacctac
gacccggtcgacgcggaccaactgctccactacctggagagcacgaccgggcagctgctc
atcgagggcatcaccgaggccggttccgtcgccgagttcgccgccgccgcgacgtcgtac
gccacgcacggcgaacccatgatccccttctacatcttctacgccatgttcggtttccag
cggaccggcgaccagttctgggcgctcggcgaccagatgggccgcggcttcgtggtcggc
ggcaccgccgggcgcacgacgatgaccggcgagggcctccagcacggggacggccactcg
cacctgctcgccgccaccaatccggcggccgtcagctacgacccggcgttcgcctacgag
atcgcggtcatcgtccgggacggtctgcgccgcatgtacggcgagcggcccgagaacgtc
ttctactacctgaccgtgtacaacgagcccaagcaccagcccgccatgccgccggttccc
ggcatcgaggagggcatcgtccggggcatctaccggttccggcccgccgaggcgcccgcg
gccgggccccggctccagctgctcgcctccggtacggcgatccactgggtcctgcgcgca
caggagctgctcgcctccgactggggcgtgcacgccgacgtgtggtcggtgacgtcctgg
acggagctgcgccgggacgcgatgcgtgccgacgacgcccggacgcggggcgaggaacgc
acccccttcgtcactcgggccctgtccggggcgccggggccggtgctggccgtcagcgac
tggatgcggcaggtgcccgaccagatcagccagtgggtcgagcaggactactactccctg
ggaaccgacggtttcgggctgtccgacacccgtgaggacgtgcgccgctacttccgggtg
gacgccgagtcgatcgtggtgaccgcgctggaccgtctggcccgtgcgggccaggtcccg
ccggagaccgtcgcgcgggcccgcgcgcagtacggcctcggccgctga

DBGET integrated database retrieval system