KEGG   Streptomyces coelicolor: SCO7443Help
Entry
SCO7443           CDS       T00085                                 

Gene name
pgm
Definition
(RefSeq) phosphoglucomutase
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Organism
sco  Streptomyces coelicolor
Pathway
sco00010  Glycolysis / Gluconeogenesis
sco00030  Pentose phosphate pathway
sco00052  Galactose metabolism
sco00230  Purine metabolism
sco00500  Starch and sucrose metabolism
sco00520  Amino sugar and nucleotide sugar metabolism
sco00521  Streptomycin biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
Module
sco_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO7443 (pgm)
   00030 Pentose phosphate pathway
    SCO7443 (pgm)
   00052 Galactose metabolism
    SCO7443 (pgm)
   00500 Starch and sucrose metabolism
    SCO7443 (pgm)
   00520 Amino sugar and nucleotide sugar metabolism
    SCO7443 (pgm)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SCO7443 (pgm)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SCO7443 (pgm)
Enzymes [BR:sco01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     SCO7443 (pgm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Motif
Other DBs
NCBI-GeneID: 1102881
NCBI-ProteinID: NP_631492
Kitasato: SCO7443
UniProt: Q9L117
Position
8256653..8258293
Genome map
AA seq 546 aa AA seqDB search
MQHDRAGRPAGPEDLIDVARLVTAYYALHPDPGEPAQRVAFGTSGHRGSSLVAAFNDDHI
AATSQAICEYRSAQGTDGPLFLGADTHALSEPARVTALEVFAANDVTVLIDSADGYTPTP
AVSHAILTHNRGRTSGLADGVVVTPSHNPPADGGFKYNPPNGGPAGSDATSWIQDRANEI
IAAGLKDVRRIPYARALAAPGTGRHDFLDAYVRDLPSVLDLDAIRSAGVRIGADPLGGAS
VAYWGRIAEQHRLDLTVVNPLADPTWRFMTLDWDGKIRMDCSSPHAMASLIQGRDRFDIA
TGNDADADRHGIVTPDAGLMNPNHYLATAIAYLYAHRADWPAGAGVGKTLVSSGMIDRVA
ADLGRRLVEVPVGFKWFVDGLVDGSLGFGGEESAGASFLRRDGSVWTTDKDGIILALLAS
EITAVTGKTPSEHYAALTARFGDPAYARIDAPATREEKARLARLSPAQVTADTLAGEPVT
AVLTEAPGNGAPIGGIKVTTENAWFAARPSGTEDVYKIYGESFLGADHLRQVQDEAKLVV
LGALGG
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgcagcacgaccgagccggccggccggccggccccgaggacctgatcgacgtcgccagg
ctggtgacggcgtactacgccctgcacccggaccccggcgagcccgcccagcgcgtggcc
ttcggtacgtccgggcaccggggctcgtcgctggtggcggcgttcaacgacgaccacatc
gccgccaccagccaggccatctgcgagtaccgctcggcacagggcaccgacggcccgctc
ttcctgggcgccgacacccacgccctgtccgagcccgcgagggtcaccgcgctggaggtg
ttcgccgccaacgacgtgaccgtgctcatcgacagcgcggacggctacacccccaccccg
gcggtctcccacgccatcctcacccacaacaggggccgcacctcgggcctcgccgacggc
gtggtcgtcaccccctcgcacaacccgcccgccgacggcgggttcaagtacaacccgccc
aacggcggccccgcgggctcggacgccacctcctggatccaggaccgggccaacgagatc
atcgcggccggactgaaggacgtacggcgcatcccgtacgcgcgggcgctcgccgccccc
ggcaccggccgccacgacttcctcgacgcctacgtccgcgacctgccgagcgtcctggac
ctcgacgcgatccgctcggcgggcgtgcggatcggcgcggacccgctgggcggcgcctcc
gtcgcctactggggccggatcgccgagcagcaccgcctcgacctgacggtggtcaacccg
ctcgccgacccgacctggcggttcatgacgctggactgggacggcaagatccgcatggac
tgctcgtcgccgcacgccatggcctccctcatccaggggcgcgaccgcttcgacatcgcc
accggcaacgacgccgacgccgaccggcacggcatcgtcaccccggacgccggcctgatg
aaccccaaccactacctcgccaccgccatcgcctacctctacgcccaccgcgccgactgg
ccggccggcgcgggcgtgggcaagacgctggtgtcctccggcatgatcgaccgggtcgcc
gccgacctcggccgccgcctggtcgaagtacccgtgggcttcaagtggttcgtggacgga
ctggtcgacggctccctcggcttcggcggcgaggagtccgcgggggcgtcgttcctgcgc
cgggacggctccgtgtggaccaccgacaaggacggcatcatcctcgcgctgctcgcctcc
gagatcaccgccgtcaccggcaagaccccctccgagcactatgccgcgctcaccgcccgg
ttcggcgaccccgcctacgcccgcatcgacgctcccgccacccgcgaggagaaggcccgc
ctggccaggctgtccccggcccaggtcacggccgacaccctcgccggggagccggtcacc
gccgtgctcaccgaggcacccggcaacggcgcccccatcggcggcatcaaggtgaccacc
gagaacgcctggttcgcggcccgcccctccggcaccgaggacgtctacaagatctacggc
gagtccttcctcggcgcggatcacctgcgccaggtgcaggacgaggccaagctcgtcgtc
ctcggcgccctgggcggctga

DBGET integrated database retrieval system