KEGG   Streptomyces coelicolor: SCO7511Help
Entry
SCO7511           CDS       T00085                                 

Gene name
gap2, SCBAC25F8.03c
Definition
(RefSeq) glyceraldehyde 3-phosphate dehydrogenase
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
sco  Streptomyces coelicolor
Pathway
sco00010  Glycolysis / Gluconeogenesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
sco01230  Biosynthesis of amino acids
Module
sco_M00002  Glycolysis, core module involving three-carbon compounds
sco_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO7511 (gap2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sco04131]
    SCO7511 (gap2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sco04147]
    SCO7511 (gap2)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     SCO7511 (gap2)
Membrane trafficking [BR:sco04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SCO7511 (gap2)
Exosome [BR:sco04147]
 Exosomal proteins
  Proteins found in most exosomes
   SCO7511 (gap2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N DapB_N NAD_binding_3 GFO_IDH_MocA 2-Hacid_dh_C ADH_zinc_N
Motif
Other DBs
NCBI-GeneID: 1102949
NCBI-ProteinID: NP_631556
Kitasato: SCO7511
UniProt: Q93J08
Position
complement(8325357..8326355)
Genome map
AA seq 332 aa AA seqDB search
MTRIGINGFGRIGRNVLRALLERDTKLEVVAVNDLTEPATLARLLAFDSTAGRLGRPVTV
DGDTLVVDGHRIKVLAEREPARLPWAELGVDIVLEATGRFTSADAARAHLTAGARKVLVS
APSSGADVTLAYGVNTDAYDPAAHTIVSNASCTTNALAPLAAVLDELAGIEHGFMTTVHA
YTQEQNLQDGPHRDARRARAAGVNIVPTTTGAAKAIGLVLPGLDGKLSGDSIRVPVPVGS
IVELNTTVARDVTREDVLAAYRAAADGPLAGVLEYSDDPLVSSDITGNPASSIFDSALTR
VEGRHIKVVAWYDNEWGFSNRVIDTLALLATR
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgactcgcatcggcatcaacggattcggccgcatcgggcgcaacgtgctgcgcgcactg
ctcgaacgcgacacgaagctcgaggtcgtcgccgtcaacgacctcacggagcccgccacc
ctggcccgtctgctcgccttcgactcgacggccggccggctcggccgcccggtgacggtc
gacggtgacaccctggtcgtcgacgggcaccgcatcaaggtgctcgccgagcgcgagccg
gcccggctgccctgggccgagctgggcgtcgacatcgtgctggaggcgaccggccgcttc
acctcggccgacgccgcccgcgcccacctcaccgcgggcgcgcgcaaggtcctggtcagc
gcgccgtccagcggtgcggacgtgacgctcgcgtacggcgtgaacaccgacgcctacgac
ccggccgcgcacacgatcgtctccaacgcctcctgcaccaccaacgccctcgcgccgctc
gccgcggtgctggacgagctggccggcatcgagcacggcttcatgacgacggtgcacgcc
tacacgcaggagcagaacctccaggacggcccgcaccgcgacgcgcgccgcgcccgcgcc
gccggggtgaacatcgtcccgaccacgacgggcgccgccaaggcgatcggcctggtgctg
ccgggcctcgacggcaagctgtcgggcgactcgatccgcgtgccggtcccggtgggctcg
atcgtcgagctgaacacgacggtcgcgcgcgacgtgacgcgcgaggacgtcctggcggcc
taccgcgccgccgccgacggcccgctcgccggcgtgctggagtactcggacgacccgctg
gtctcctccgacatcacgggcaacccggcctcgtcgatcttcgactcggcactgacccgc
gtggaaggacgccacatcaaggtggtcgcctggtacgacaacgaatggggcttctcgaac
cgcgtgatcgacaccctcgcgctgctcgccacacgctga

DBGET integrated database retrieval system