KEGG   Streptomyces coelicolor: SCO7558Help
Entry
SCO7558           CDS       T00085                                 

Gene name
SC5F1.12
Definition
(RefSeq) beta-glucosidase
  KO
K05350  beta-glucosidase [EC:3.2.1.21]
Organism
sco  Streptomyces coelicolor
Pathway
sco00460  Cyanoamino acid metabolism
sco00500  Starch and sucrose metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SCO7558 (SC5F1.12)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    SCO7558 (SC5F1.12)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     SCO7558 (SC5F1.12)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 1102996
NCBI-ProteinID: NP_631601
Kitasato: SCO7558
UniProt: Q9F3B7
Position
8380679..8382118
Genome map
AA seq 479 aa AA seqDB search
MVTAAHRTASAPDAARTFPKGFLWGSATASYQVEGAAAEDGRTPSIWDTYARTPGRVRNG
DTGDVATDHYHRRSEDVALMAELGLGAYRFSLAWPRIQPTGRGPAVQKGLDFYRRLVDEL
LEKGIQPVATLYHWDLPQELEDAGGWPERATAERFAEYAALAADALGDRVRTWTTLNEPW
CSAFLGYGSGVHAPGRTDPVAALRAAHHLNLAHGLAVQALRERVRADAQVSVTLNIHHVR
PLTGSEGDADAARRIDALANRVFTGPMLNGAYPEDLLKDTAELTDWSFVQDGDLRQAHQP
LDFLGVNYYTPTVVSETDGSGAHTSDGHGNSSHSPWPGADRVAFHQPPGDTTAMGWAVDP
TGLYDLLRRLSADFPRLPLVITENGAAFDDYADPEGQVNDPARIAYVRGHLAAVHQAILD
GADVRGYFLWSLLDNFEWAHGYSKRFGAVYVDYPTGTRIPKASARWYSEVARTGVLPGA
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
gtggtcaccgcagcacaccggaccgcgtccgccccggacgccgcccgcaccttccccaag
ggcttcctctggggctccgccaccgcttcctaccaggtcgagggagccgccgcggaggac
ggccgcaccccgtccatctgggacacctacgcccgcacccccggccgggtccgcaacggt
gacaccggtgacgtcgccaccgaccactaccaccgccggagcgaggacgtcgccctcatg
gccgaactcggcctgggcgcctaccgcttctccctcgcctggccccggatccagcccacc
ggccgcggccccgccgtgcagaagggcctggacttctaccggcggctggtggacgagctg
ctggagaagggcatccagcccgtcgccaccctctaccactgggacctgccccaggaactg
gaggacgccggcggctggcccgagcgcgccacggccgagcggttcgccgagtacgcggcc
cttgccgccgacgccctgggcgaccgggtgaggacctggaccaccctcaacgagccctgg
tgcagtgccttcctcggctacggctccggcgtgcacgcgccgggccgcaccgacccggtc
gccgcgctgcgcgccgcccaccacctcaacctggcgcacggcctggccgtccaggcgctg
cgcgaacgggtccgcgccgacgcccaggtctccgtcaccctcaacatccaccacgtccgc
ccgctcaccggcagcgagggcgacgccgacgcggcccgccggatcgacgccctggccaac
cgggtcttcaccggcccgatgctgaacggtgcctacccggaggacctgctgaaggacacc
gccgagctgaccgactggtccttcgtgcaggacggcgacctgcgccaggcccaccagccg
ctggacttcctcggcgtcaactactacacgcccaccgtcgtctccgagaccgacggcagc
ggcgcccacacgtccgacgggcacggcaacagctcccacagcccctggccgggagccgac
cgggtcgccttccaccagccgcccggcgacaccaccgccatgggctgggccgtcgacccc
accggcctgtacgacctgctgcgccggctgtccgccgacttcccgaggctgccgctggtc
atcaccgagaacggcgccgccttcgacgactacgccgatcccgaggggcaggtcaacgac
cccgcccggatcgcctacgtccgcggtcacctggccgccgtccaccaggccatcctggac
ggtgcggacgtgcgcggctacttcctgtggtccctgctggacaacttcgagtgggcgcac
ggctacagcaagcgcttcggcgcggtctacgtcgactacccgaccggcacccgcatcccc
aaggcgagcgcccgctggtactccgaggtcgcccgcaccggcgtactgcccggcgcctga

DBGET integrated database retrieval system