KEGG   Streptomyces coelicolor: SCO0164
Entry
SCO0164           CDS       T00085                                 

Gene name
SCJ1.13
Definition
(RefSeq) cation-transporting ATPase
Organism
sco  Streptomyces coelicolor
Motif
Pfam: E1-E2_ATPase Hydrolase Hemerythrin Hydrolase_3 HAD
Other DBs
NCBI-GeneID: 1095588
Kitasato: SCO0164
UniProt: Q9RJ01
Position
153398..155728
AA seq 776 aa
MDRFLLVARLRRSTAVLASPLLERGLLAVTTAALTGGGVAHFLDADGIAELFWGLGTVAA
VIPAVGWVLVALRRGHAGVDLIAVLALGGTLAVGEYLAGVLIALMLATGRTLEGAAQRRA
SHDLHALLAHAPRSARRRTGDGVVRVPLSEITAGDALVVGPGEVVPVDGRVESTEAVLDE
SVLTGEPLQVTRQRGEGARSGAVNAGGAFDLRATAIEQDSTYAGIVRLAQQAGAESAPVV
RLADRYAAWFLPLALATAALAWLVSGSAVRAVAVLVVATPCPLLLAAPVAVVSGLSRASR
RGVVVRDGGALENLGRARTLLLDKTGTLTVGRPCVLDVVAAPGHVPAEVLRVAASLDQLS
PHVLAQAIVDAARTRRLELSAPTEVTEEPGRGASGVVEGHRVFIGRDDPTRARPNWAKAV
GNRALLDGASVAWLTVDERLTGAVLLRDALRRDAPHAVRRLRSAGIERLVMLTGDRAATA
QEVAAVLGLDGVRAELGPADKVAAVRGEREHAVTVMVGDGVNDAPALAAADIGVAMGARG
TTASSEAADIVLTTDRVDRLADAVVIAQRSRRIAVQSALGGMLLSLGAMAAAALGLIQPA
AGALLQEGIDVAVILNALRALRADHAGQGVLAPATEALIHRFAAEHEDLQDVLQAVRDAA
DRLSGVPGPTALASVEEAHRLLTERLLPHEYAEEHQLYPALAPALGGPESTVTMSRAHTE
IGRLSRRIATHLQLARTNGGLAPEQLDDLRSCLYGLNTVLRLHFTQEEESYFSLAP
NT seq 2331 nt   +upstreamnt  +downstreamnt
atggaccgctttctcctcgtcgcgcgactgcgccgctcgacggcggtgctcgcgtccccc
ctcctcgagcgtgggctcctcgccgtcacgaccgcggctctgacaggtggcggcgtcgcc
cacttcctcgacgccgacggcatcgccgagctcttctggggactgggtaccgtggccgcc
gtcatccccgcggtgggctgggtgctggtcgcactccggcgggggcacgccggcgtggac
ctgatcgccgtactcgcgctcggcggcaccctggccgtcggtgagtacctggccggggtc
ctgatcgcgctcatgctggccacgggccgcaccctggagggggccgctcaacgacgcgcc
tcccacgacctgcacgccctgctcgcacacgcgccgcgctcggcccgccgtcgcaccggc
gacggcgtggtgagagtacccctgagcgagatcactgccggggacgctctggtcgtcggc
ccgggtgaggtcgtcccggtcgacggccgcgtcgaaagcaccgaagccgtcctcgacgag
tcggtgctcactggtgaacccctccaggtcacacgccaacggggggaaggggcacgcagt
ggcgcggtcaacgccggcggcgcgttcgacctgcgcgccaccgccatcgaacaggacagc
acctacgccggcatcgtgcggctcgcccagcaggcgggtgcggaatcggcgccggtggtg
cggctggcggaccggtacgccgcctggttcctcccgctggccctcgccacggcggcactg
gcgtggctggtcagtggctccgcggtgcgtgcggtcgccgttctggtggtcgccaccccg
tgccccctgctactggctgctccggtggccgtcgtctccggtctttcccgtgcctcccgc
cgcggtgtggtcgtccgggatggcggagcgctggaaaacctgggccgggcccgcaccctc
ctgctggacaagacggggaccctgaccgtgggccgcccgtgcgtcctggatgtggtggct
gctccgggccacgtgccggcggaggtcctgcgagtggccgcctcgctggaccagctttcg
cctcatgtgctggcccaggcgatcgtcgacgccgcgcggactcggagactggagctgtcg
gcgccgacggaggtgacggaggagccgggtcggggggccagtggcgtcgtggagggccac
cgggtcttcatcggtcgcgacgaccccacccgggcgcggccgaactgggcgaaggcggtc
ggcaaccgcgccctcctcgacggggcgagcgtggcatggctgactgtcgatgaacgcctc
accggtgccgtcctgctgcgcgacgccctgcgccgcgacgctccgcacgccgtgcgccgg
ctccggtccgccggcatcgagcgactggtgatgctcacgggcgaccgggcggccacggct
caagaggtggcggccgttctgggactcgacggcgtccgcgccgagctcggtcccgccgac
aaggtggccgccgtgcgcggtgaacgcgagcacgccgtcacggtgatggtcggcgacggg
gtcaacgacgcacctgccctggccgctgcggacatcggtgtcgccatgggtgcccggggc
accacggcgtcctccgaggcggccgacatcgtgctcaccaccgaccgcgtcgaccgcctg
gccgacgccgttgtcatcgctcagcggtcacgccgtatcgccgtccagagcgccctcgga
ggcatgctgctgtcgctgggtgcgatggccgcggccgcgctcggtctgatccagcccgcc
gccggtgccctgctgcaagagggcatcgacgtcgcagtcatcctcaacgcgctgcgcgcc
ctgcgcgccgaccacgccgggcaaggggtcctcgctcctgccaccgaagccctcatccac
cgtttcgccgccgagcacgaggacctgcaggacgttctccaggcggtgcgcgacgccgcg
gaccgcctctccggtgtccccgggccgacggccctcgcgagcgtcgaggaggcgcaccgc
ctgctcaccgagcgactgctgccgcacgagtacgccgaggagcatcagctctacccggct
ctcgcaccggctctcggtggccccgagtccacggtgacgatgagccgcgcgcacaccgag
atcggacgtctgtcccgccgcatcgccacccacctgcaactcgctcgcacgaacggcggc
ctggcccccgaacagctggacgacctgcgctcctgcctgtacggcctcaacacggtgctg
cgtctgcacttcacccaggaggaggagagctacttctccctggctccgtga

DBGET integrated database retrieval system