KEGG   Streptomyces coelicolor: SCO0404Help
Entry
SCO0404           CDS       T00085                                 

Gene name
SCF51.03
Definition
(RefSeq) 2-haloalkanoic acid dehalogenase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
sco  Streptomyces coelicolor
Pathway
sco00361  Chlorocyclohexane and chlorobenzene degradation
sco00625  Chloroalkane and chloroalkene degradation
sco01100  Metabolic pathways
sco01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SCO0404 (SCF51.03)
   00361 Chlorocyclohexane and chlorobenzene degradation
    SCO0404 (SCF51.03)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     SCO0404 (SCF51.03)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase Hydrolase_like HAD_2
Motif
Other DBs
NCBI-GeneID: 1095827
NCBI-ProteinID: NP_624725
Kitasato: SCO0404
UniProt: Q9RJT2
Position
425243..425983
Genome map
AA seq 246 aa AA seqDB search
MVASGRESAEEGVRAGMAGGILGIEVVVFDVLGTLVDEPGGLRAGIREAVPAADDAFVDE
LLALWQGHVEREQRRVVRGRRAYADSGIIDAEAARLVADRAGVGDPAAVDRLAGAGRRLP
PWSDSAAGLDRLTRRLVVLGLSNASHTAVPRIAAYAGLRWHGALSGETVRAYKPAPEVYR
LAVDTAGCPPDRVLMVAAHAWDLRGARAGGMRTAYVRRPGGDPPTGSDDFDGRFEALDEL
ADALRL
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
gtggtggcgagcgggcgcgagagcgcggaagaaggagtgagggcgggcatggctggtggg
atcctcggcatcgaggtcgtcgtcttcgacgtcctcggcacactggtggacgagcccggc
gggcttcgggcggggatccgggaggcggtgcccgcggccgacgacgcgtttgtcgacgag
ttgctcgccctgtggcaggggcacgtggagcgggagcagcggcgcgtcgtgcgggggcgg
cgcgcgtacgccgacagcgggatcatcgacgcggaggccgctcggctggtggccgaccgt
gcgggcgtcggtgatccggcggccgtcgaccggctggccggggcgggccggcgcctgccg
ccctggagcgactccgccgccggactggaccggctgacgcggcgcctggtggtgctgggc
ctctccaacgccagtcacaccgccgtgccgcggatcgccgcgtacgccgggctgcgctgg
cacggggccctgtcgggcgagaccgtccgcgcctacaagccggcgccggaggtctaccgg
ctcgccgtcgacaccgcggggtgcccgccggaccgcgtgctcatggtggccgctcacgcc
tgggacctccgcggcgcccgggcgggcggcatgcggaccgcgtacgtgcgccgccccggc
ggagatccgccgacgggctccgacgacttcgacggacgcttcgaggcactggacgaactg
gccgacgcgctccgcctctga

DBGET integrated database retrieval system