KEGG   Streptomyces coelicolor: SCO0663Help
Entry
SCO0663           CDS       T00085                                 

Gene name
SCF91.23
Definition
(RefSeq) 2-hydroxyacid dehydrogenase
Organism
sco  Streptomyces coelicolor
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh
Motif
Other DBs
NCBI-GeneID: 1096086
NCBI-ProteinID: NP_624972
Kitasato: SCO0663
UniProt: Q9RJA1
Position
700681..701712
Genome map
AA seq 343 aa AA seqDB search
MTVHAPGPGHRPRAAVAMSPDAASAVLDPQSLAAFRRVCDLAPFPVLDDLSTARARSVLA
DVELLVTGWGCPPLDAQVLRSAPRLRAVVHTAGSVRGHVTDACWERGVEVSSAAAANALP
VAEYTLGMILLSGKRVLERARDYRASRVRGNWLRTPRGVGNYRRTVGILSASLIGRRVVE
LLRPHDIEVLLHDPYVTDAEAAELGVENVGLPELFARCDTVSVHTPLLPTTRGLVSRPLI
EAMPADAVLINTSRGAVIDQDALTDAALAGRIRAVLDVTDPEALPPEHPLWDCEHALITP
HLAGSEGNEWRRLADLALAETTRWASGSGFLHPVRRERLAFLA
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtgcacgcccccggacccggccaccggccccgtgccgccgtggccatgtccccg
gacgccgcctcggccgtcctggacccccagtccctcgccgccttccgccgggtctgcgac
ctcgcgccgttcccggtgctcgacgacctgtccacggcgcgggcgagatccgtactggcg
gacgtggagctgctggtcaccgggtggggctgtccgccgctggacgctcaggtgctgcgg
tcggcgccccggctgcgggccgtggtgcacacggcgggcagtgtccgcggacatgtcacc
gacgcgtgctgggagcggggcgtcgaggtctcctcggccgccgccgccaacgcgctgccg
gtggccgagtacaccctcggcatgatcctgctgagcggcaagcgggtgctggagcgggcc
cgcgactaccgggcctcccgggtgcgcgggaactggctgcgcaccccgcgcggcgtcggc
aactaccgccggacggtggggatcctgtcggcgtcgctgatcggccgccgggtcgtcgaa
ctgctgcggccgcacgacatcgaggtcctcctgcacgacccgtacgtgaccgacgccgag
gccgccgagctgggcgtcgagaacgtggggctgccggagctgttcgcgcgctgcgacacc
gtcagcgtgcacaccccgctgctgcccaccacccgcggtctggtgagccgtccgctgatc
gaggcgatgccggccgacgcggtgctgatcaacacctcgcggggcgcggtgatcgaccag
gacgcgctcaccgacgccgcgctggcgggccgcatccgcgccgtcctggacgtcaccgac
cccgaggcgctgccgccggagcacccgctgtgggactgcgagcacgccctgatcaccccg
cacctcgccggttccgagggcaacgagtggcgccggctggccgacctcgccctcgccgag
acgacccgctgggcgtccggttccggcttcctccaccccgtacgacgcgaaaggctggcg
ttcctggcatga

DBGET integrated database retrieval system