KEGG   Streptomyces coelicolor: SCO0811Help
Entry
SCO0811           CDS       T00085                                 

Gene name
SCF43.22c, SCF43A.01c
Definition
(RefSeq) ABC transporter ATP-binding protein
  KO
K10562  rhamnose transport system ATP-binding protein [EC:7.5.2.-]
Organism
sco  Streptomyces coelicolor
Pathway
sco02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SCO0811 (SCF43.22c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sco02000]
    SCO0811 (SCF43.22c)
Transporters [BR:sco02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Rhamnose transporter
    SCO0811 (SCF43.22c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_29 RsgA_GTPase Zeta_toxin TsaE AAA_22 AAA_16 AAA_23 MMR_HSR1 MukB AAA_25 AAA_30
Motif
Other DBs
NCBI-GeneID: 1096234
NCBI-ProteinID: NP_733516
Kitasato: SCO0811
UniProt: Q8CK44
Position
complement(858169..859686)
Genome map
AA seq 505 aa AA seqDB search
MTHPSDTGSAPVLALRDVSKSFGAVRALRDVSLELFPGEVHALAGENGAGKSTLIKTLAG
VHRPDAGHVLLDGAPVVFHGPGDARDAGIAVIYQEPTLFPDLSIAENIFMGRQPRRALGR
IDHKATHDATAALMLRLGVELDPDRPARGLSIADQQIVEIAKALSFDARVLIMDEPTAAL
TGSEVARLFGVVRTLRDQGAAVLFISHRLEEIFHICARVTTLRDGAWIASEPLEGMTEDD
LVRRMVGRDLDELYPKQEVTPGERALSVRRLTREGVFTDVSFEVRRGEIVALAGLVGAGR
TEVARAVFGVDRWDAGEVEVDGKPLVNGAPSTAMAAGLALVPEDRRAQGLVMDMSIERNI
GLTGLRTTVKAGLVDRGAERSRSLDWAVKLQVKYARIADTVATLSGGNQQKVVLAKWLAT
GPKVLIVDEPTRGIDVGTKAEVHRLLSQLAADGVAVLMISSDLPEVLGMADRVLVMHEGR
LTAEISRTDATEETVMAAATGRAAA
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgacccacccgtccgacacgggttcggccccggttctggcgctcagggacgtctccaag
tccttcggcgcggtccgtgcgctgcgggacgtctccctggagctgttccccggcgaggtg
cacgccctcgccggtgagaacggcgccggaaagtcgaccctcatcaagacgctggccgga
gtgcaccggccggacgccggccacgtgctgctcgacggcgcaccggtcgtgttccacggt
cccggcgacgcccgcgacgccggcatcgccgtgatctaccaggagcccaccctcttcccc
gacctgtcgatcgccgagaacatcttcatgggccgccagccgcgccgcgccctcggccgc
atcgaccacaaggcgacccacgacgccaccgccgcactcatgctgcgcctcggcgtcgaa
ctcgaccccgaccggcccgcgcgcggtctgtccatcgcggaccagcagatcgtggagatc
gccaaggccctctccttcgacgcccgcgtcctgatcatggacgagccgaccgccgccctc
accggcagcgaggtggcccggctcttcggcgtggtgcgcaccctgcgcgaccagggcgcc
gcggtgctgttcatctcccaccgcctggaggagatcttccacatctgcgcgcgggtgacc
accctgcgcgacggcgcctggatcgccagcgagcccctggagggcatgaccgaggacgac
ctggtgcgccgcatggtcggccgcgacctcgacgagctgtaccccaagcaggaggtcacc
cccggcgagagggccctcagcgtgcgcaggctgacccgcgagggcgtcttcaccgacgtc
tccttcgaggtgcggcgcggtgagatcgtcgcgctggccggactggtcggcgccgggcgc
accgaggtcgcccgcgccgtcttcggcgtcgaccgctgggacgcgggcgaagtggaggtg
gacgggaagccgctcgtcaacggcgcgccctccaccgcgatggccgccggtctcgccctc
gtcccggaggaccgccgcgcccaggggctggtgatggacatgtccatcgaacgcaacatc
gggctcaccggcctgcggacgaccgtgaaggccggcctcgtggaccgcggcgccgagcgc
agccgttccctggactgggcggtcaagctccaggtcaagtacgcccgcatcgccgacacc
gtcgccaccctgtccggcggcaaccagcagaaggtcgtcctcgccaagtggctggccacc
ggccccaaggtgctgatcgtggacgagcccacccgcggcatcgacgtcggcaccaaggcg
gaggtgcaccggctcctctcgcagctcgccgccgacggcgtggccgtcctgatgatctcc
tccgacctgcccgaggtgctcggcatggccgaccgcgtcctggtgatgcacgagggccga
ctgaccgccgagatatcccgcaccgacgccaccgaggagaccgtgatggccgcagcgacg
gggagggccgccgcatga

DBGET integrated database retrieval system