KEGG   Streptomyces coelicolor: SCO0857Help
Entry
SCO0857           CDS       T00085                                 

Gene name
SCM2.10
Definition
(RefSeq) TetR family transcriptional regulator
Organism
sco  Streptomyces coelicolor
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_C_16 TetR_N
Motif
Other DBs
NCBI-GeneID: 1096280
NCBI-ProteinID: NP_625157
Kitasato: SCO0857
UniProt: Q9RCV4
Structure
PDB: 

Position
904109..904747
Genome map
AA seq 212 aa AA seqDB search
MTGQAAGPAAGPAAGQATKHAGGRRPGETRTREAILTAARVCFAERGFDATSLRRIAETA
GVDQSLVHHFYGTKENLFLQALELPGKIEEAITAAAQGGLDGIGERVVRAHLSVWDDVSS
RPALMTMVRSAAIHRAAAARLRETATGILARALGGVITGEDAMLRTSMVATQLVGLAMMR
YVAHLEPLASADTDTVARHYGRAVQAIVTDRD
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
gtgactggccaggcggccggtccggcggccggtccggcggctggtcaggcgacgaagcac
gccgggggcaggcggcccggggagacccgtacgcgggaggcgatcctgaccgcggcacgg
gtctgcttcgccgagcgcggtttcgacgcgaccagcctgcgccgcatcgcggagacggcg
ggggtggaccagtcgctggtgcaccacttctacggcacgaaggagaacctgttcctccag
gcgctggaactgccggggaagatcgaggaggccatcaccgccgcggcgcagggcggactg
gacgggatcggggaacgcgtggtgcgcgcccacctgtcggtgtgggacgacgtgtcgtca
cgtccggcactcatgaccatggtgcgctcggccgccatccaccgtgccgccgccgcccgg
ctccgtgagaccgcgaccggcatcctggcgcgcgcactcggcggggtgatcacgggcgag
gacgcgatgctccgcacgagcatggtcgccacgcagctcgtcgggctcgccatgatgcgt
tacgtggcgcatctcgaacccctcgcctcggccgacaccgacacggtggcccgccactac
ggccgcgctgttcaggcgatcgtgacggacagggactga

DBGET integrated database retrieval system