KEGG   Streptomyces coelicolor: SCO1363
Entry
SCO1363           CDS       T00085                                 

Symbol
SC10A9.05c
Name
(RefSeq) hypothetical protein
Organism
sco  Streptomyces coelicolor
SSDB
Motif
Pfam: EamA SLC35F
Other DBs
NCBI-GeneID: 1096786
Kitasato: SCO1363
UniProt: Q9AK99
Position
complement(1441026..1442030)
AA seq 334 aa
MPVHTSDSARGSRGKGIGLGLALASAVAFGGSGVAAKPLIEAGLDPLHVVWLRVAGAALV
MLPLAVRHRALPRRRPALVAGYGLFAVAGVQACYFAAISRIPVGVALLVEYLAPALVLGW
VRFVQRRPVTRAAALGVVLAVGGLACVVEVWSGLGFDALGLLLALGAACCQVGYFVLSDQ
GSDAGEEAPDPLGVIAYGLLVGAAVLTIVARPWSMDWSVLAGSAPMDGTPVAAALLLAWI
VLIATVLAYVTGIVAVRRLSPQVAGVVACLEAVIATVLAWVLLGEHLSAPQVVGGIVVLA
GAFIAQSSTPAKGSADPVARGGPERELSSRGTST
NT seq 1005 nt   +upstreamnt  +downstreamnt
gtgccggtgcatacgtctgacagcgcccgcggcagccgcggcaagggcatcgggctcggc
ctggcactggcctccgcggtcgccttcggaggttccggagtcgcggccaaaccgctcatc
gaggccgggctcgatccgctccacgtggtctggctgcgcgtcgcgggcgcggccctggtg
atgctgccgctcgccgtgcgccaccgcgccctgccgcgccgccgtcccgcgctggtcgcc
gggtacggactgttcgccgtggccggtgtccaggcgtgctacttcgcggccatctcgcgc
atccccgtcggcgtcgccctgctggtcgagtacctggcgcccgctctggtcctcggctgg
gtgcggttcgtgcaacggcggccggtcacacgcgccgccgcgctcggcgtggtcctggcg
gtcggcggcctcgcctgcgtggtcgaggtctggtcggggctgggcttcgacgccctcgga
ctgctgctcgccctcggcgccgcttgctgccaggtcggctacttcgtcctgtccgaccag
ggcagcgacgccggcgaggaggcgcccgacccgctcggcgtcatcgcctacggcctgctg
gtcggcgccgccgtgctcaccatcgtcgcccggccctggtcgatggactggtccgtcctc
gccggctcggcacccatggacggcacacccgtcgccgccgccctgctgctggcctggatc
gtgctcatcgccacggtgctcgcctacgtcaccggaatcgtggccgtacgtcggctgtcg
ccgcaggtcgccggagtcgtggcgtgcctggaagcggtcatcgcgacggtcctggcgtgg
gtgctgctgggcgagcacctctccgccccgcaggtcgtcggcggcatcgtggtgctggcg
ggcgccttcatcgcccagtcctcgaccccggcgaagggctccgcggacccggtggccagg
ggcggtcccgaaagggagttgtcgagccggggaacgtcgacctag

DBGET integrated database retrieval system