KEGG   Streptomyces coelicolor: SCO1457
Entry
SCO1457           CDS       T00085                                 

Gene name
SCL6.14c
Definition
(RefSeq) transporter
Organism
sco  Streptomyces coelicolor
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 1096883
Kitasato: SCO1457
UniProt: Q9L102
Position
complement(1554266..1555507)
AA seq 413 aa
MTVSPLPERAATAPAGTRRLVRTLYASAFCDEFVLLYPVYALLFSDTGLSVWQTASLFGL
WSLTGILLEVPSGAWADAVSRRLLLILGPLLTAAGFALWVLAPSYGAFALGFVLWGAGGA
LGSGALEALVYDELERAGAAGHYARVMGRARAIGIAATMSAMGLAGPVFARGGYDAVGAA
SVLACLAAAAVATRFPEHRTPSGGGERWSATLRAGLADARADRSVRGALLLVPAVTAVWG
ALDEYTPLLAHDTGVAAETVPWLLLVIWAGATAGSLLAGAAERLTANGFAALLTGSALAL
AVGGLAGTPAALVLVALAFGGFQLATVLADARLQQRIDDTGRATLTSVAGLGTELGNLAT
YGAYAAAATAWGHGTAFALSALPYVLTALLLAGAARTTAAAATARRRSRRSPS
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgaccgtctcacctctgcccgagcgtgccgccaccgcacccgccggaacccgccggctc
gtgcgcacgctgtacgcctccgcgttctgcgacgagttcgtcctgctctacccggtgtac
gccctgctgttcagcgacaccggcctgtccgtctggcagacggcctcgctgttcggcctg
tggtcgctgaccggcatcctgctcgaagtgccctccggcgcctgggccgacgccgtctcc
cggcggctgctgctgatcctcggcccgctgctcaccgccgccggcttcgcactgtgggtg
ctcgcgccctcctacggcgccttcgcgctcggcttcgtgctgtggggcgccggcggcgcg
ctcggctcgggcgcgctggaggcgctggtctacgacgaactcgagcgggccggcgcggcc
ggccactacgcccgcgtcatgggccgggcccgggcgatcggcatcgccgcgaccatgtcc
gccatgggcctggccggcccggtgttcgcccggggcggctacgacgcggtgggcgccgcg
agcgtgctcgcctgtctggcggcggcggccgtggccacccggttccccgagcaccggaca
ccctccggcggcggcgaacgctggtccgcgacactgcgcgcgggactcgccgacgcccgc
gccgaccggtccgtgcgcggtgcgctgctcctcgtaccggccgtgaccgcggtgtggggc
gcgctcgacgagtacacgccgctgctggcgcacgacaccggcgtggcggccgagaccgtg
ccctggctgctgctggtgatctgggccggagccacggccggcagcctgctggccggtgcg
gcggagcgcctgaccgccaacgggttcgccgcgctgctcaccggttccgcgctcgccctg
gccgtgggcggcctggccggcacaccggccgccctggtcctggtggccctcgccttcggc
ggcttccagctggcgaccgtgctggccgacgcccgcctccagcagcgcatcgacgacacc
gggcgggccaccctgacctcggtcgcgggactcggcaccgagctgggcaacctcgccacc
tacggcgcctacgcggcggcggccacggcatggggccacggcacagccttcgcgctctcc
gcgctgccctacgtcctgacggcgctgctgctggccggcgccgcccggactacagccgcg
gctgccacggcacgacgtcgaagtcgccggtccccttcctga

DBGET integrated database retrieval system