KEGG   Streptomyces coelicolor: SCO1567Help
Entry
SCO1567           CDS       T00085                                 

Gene name
SCL24.03c
Definition
(RefSeq) transmembrane-transport protein
  KO
K08167  MFS transporter, DHA2 family, multidrug resistance protein
Organism
sco  Streptomyces coelicolor
Brite
KEGG Orthology (KO) [BR:sco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sco02000]
    SCO1567 (SCL24.03c)
   01504 Antimicrobial resistance genes [BR:sco01504]
    SCO1567 (SCL24.03c)
Transporters [BR:sco02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-2 (14 spanner) (DHA2) family [TC:2.A.1.3]
    SCO1567 (SCL24.03c)
Antimicrobial resistance genes [BR:sco01504]
 Gene variants
  Quinolone resistance genes
   Transporter
    SCO1567 (SCL24.03c)
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump QacA [MD:M00714]
    SCO1567 (SCL24.03c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 OATP PUCC Sugar_tr MFS_1_like
Motif
Other DBs
NCBI-GeneID: 1096998
NCBI-ProteinID: NP_625844
Kitasato: SCO1567
UniProt: Q9L1B4
Position
complement(1677149..1678681)
Genome map
AA seq 510 aa AA seqDB search
MNRTLQPAHPTEAVKRPGRWLALSVLVLAVLLVAVDATVLGLATPYISEDLAPSGTQLLW
IGDVYSFVIAGLLVSMGSLGDRIGRKRILLIGATAFGAISVLNAYAHTPEVMIFARALLG
VAGATLMPATLALIRNLFHDPRERSLAVGIWGAAASAGAAVGPVVGGFLLEHFWWGSVFL
INLPVMVVLVVVGVKMLPESRNPNPGPWDLLSVVLSLVGMVGVVYAVKETAAHGFAWATL
AAGLLGAAALYGFVRRQLTMPVPLLDMRLFRNRGFSGAVLADLLTILGLSGLVFFLSQYL
QLVQGRRPFEAGLAELPAAVGAVVAGLIAGRAARRFSVRAVVAGGLAAVGLALAALTVIG
QHTGYPLLGAALLVVGLGAGFAFTVTADVILSSVPGEQAGAASAVSETAYELGAALGIAV
LGSIVTGVYRDFTGPAGTPDAAHESLGGAVEAAAHLPGPAGEALLDSARQAFVDGLTLAA
GVGAAVLLAAAAASWYLLRGQRLEDGVEHP
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcaccctgcagccggcccacccgaccgaggcggtgaagcgccccggccgctgg
ctggcgctgtccgtcctggtgctggccgtgctgctggtggccgtcgacgcgaccgtcctc
ggtctcgcgaccccctacatcagcgaggacctcgcgccctccggcacccagctgctctgg
atcggcgacgtctactccttcgtcatcgccggtctgctcgtctccatgggcagcctcggc
gaccgcatcggacgcaagcgcatcctgctcatcggcgccacggcgttcggcgcgatatcc
gtcctcaacgcctacgcgcacacacccgaggtgatgatcttcgcccgggccctgctcggc
gtcgcgggcgccaccctgatgccggccaccctcgccctgatccgcaacctcttccacgac
ccgcgtgaacgcagcctcgccgtcggcatctggggcgcggccgcctccgccggtgcggcg
gtcggtccggtggtcggcgggttcctgctggagcacttctggtggggctccgtcttcctg
atcaacctgcccgtgatggtcgtcctggtcgtcgtcggcgtgaagatgctgcccgagtcc
cgcaacccgaacccgggtccctgggacctgctcagcgtcgtcctctccctggtcggcatg
gtcggagtcgtgtacgcggtcaaggagaccgccgcccacgggttcgcctgggccacgctc
gccgcgggtctgctgggcgccgccgcgctctacggcttcgtccgccgccagctgaccatg
ccggtcccgctgctcgacatgcggctgttccgcaaccggggcttcagcggcgcggtcctg
gccgacctgctgaccatcctgggcctgtcggggctggtgttcttcctctcccagtacctg
caactcgtccagggcaggcggcccttcgaggcgggcctggccgaactgcccgccgccgtc
ggcgcggtggtggccggtctgatcgccgggcgcgcggcccggcgcttctcggtccgtgcc
gtggtcgccggcggactcgccgccgtcggcctcgcgctcgccgcgctgaccgtcatcggc
cagcacaccggctacccgctgctcggcgcggccctgctggtcgtcggcctcggcgcgggc
ttcgcgttcaccgtcaccgccgacgtgatcctctccagcgtccccggggaacaggcgggc
gccgcctcggcggtctccgagacggcgtacgaactcggcgccgcgctcggtatcgcggtg
ctgggctccatcgtgaccggtgtctaccgcgacttcaccgggcccgcgggcaccccggac
gccgcccacgagtcactgggcggcgcggtggaggccgccgcccacctcccgggccccgcc
ggcgaggcgctcctcgactccgcccggcaggccttcgtcgacggcctgaccctcgcggcg
ggcgtcggcgccgccgtactcctggccgccgcggcggcgtcctggtacctgctgcggggc
cagcgcctggaggacggggtggaacacccgtaa

DBGET integrated database retrieval system