KEGG   Streptomyces coelicolor: SCO1850Help
Entry
SCO1850           CDS       T00085                                 

Gene name
SCI8.35
Definition
(RefSeq) chelatase
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
sco  Streptomyces coelicolor
Pathway
sco00860  Porphyrin and chlorophyll metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SCO1850 (SCI8.35)
Enzymes [BR:sco01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     SCO1850 (SCI8.35)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA_2 VWA Mg_chelatase AAA_5 AAA_16 Sigma54_activat VWA_3 MCM
Motif
Other DBs
NCBI-GeneID: 1097284
NCBI-ProteinID: NP_626118
Kitasato: SCO1850
UniProt: Q9RJ18
Position
1982004..1984022
Genome map
AA seq 672 aa AA seqDB search
MSTPFPFTAVVGQDDLRLALLLNAVSPAVGGVLVRGEKGTAKSTAVRALSALMPEVDVVS
GCRFSCDPDSPDPACPDGPHEPGAFASRPARMVELPVGASEDRLVGALDIERALAEGVKA
FEPGLLADAHRGILYVDEVNLLHDHLVDLLLDAAAMGASYVEREGVSVRHASKFLLVGTM
NPEEGELRPQLLDRFGLTVEVAASREPDQRVEVVRRRLAYDDDPAGFAARWADEEAAVRA
RIVGARELLPSVRLGDGALRQIAATCAAFEVDGMRADIVMARTATALAAWAGRTEVLAED
VRQAALLALPHRRRRNPFDAPGLDEDKLDETLEEFGGQDGDGPDGDDDPDPGPGGGPGGQ
PEPDDAPQGDGDAAARPEAGEGGEPQPSGSGAGEQQPARAAEPFRTKVLSVPGLGEGAAG
RRSRARTEHGRTTGARRPQGALTKLHLAATVQAAAPHQRARGRSGPGLVVRRDDLRQATR
EGREGNLVLFVVDASGSMAARQRMSAVKGAVLSLLLDAYQRRDKVGLVTFRGSAADVALP
PTSSVDAAAVRLESLPTGGRTPLAAGLLRAHEVLRVERLRDPARRPLMVVVTDGRATGGP
EPVALAGRAARLFAAEGTASVVVDCESGPVRLGLAGQLAGELGGTAVTLDELRADSIAGL
VRDVQGSSRRAA
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaccccgttcccgttcacggccgtcgtgggccaggacgacctgcggctcgcgctg
ctgttgaacgccgtctccccggccgtcggcggtgtgctggtgcgcggcgagaagggcacc
gcgaagtccacggccgtgcgtgcgctgtcggcgctgatgcccgaggtggacgtcgtctcc
gggtgccgtttctcctgcgaccccgactcccccgaccctgcctgcccggacggcccgcac
gagccgggcgccttcgcctcgcgtccggcgcggatggtcgagctgcccgtcggggcctcc
gaggaccggctggtgggcgccctcgacatcgagcgggcgctggcggagggcgtgaaggcc
ttcgagcccggcctgctggccgacgcgcaccgcggaatcctgtacgtcgacgaggtcaac
ctgctccacgaccacctggtcgacctgctcctcgacgccgccgcgatgggcgcctcctac
gtcgagcgcgagggcgtgtccgtgcggcacgcctcgaagttcctgctggtcggcaccatg
aaccccgaagagggcgagctgcggccgcagttgctcgaccggttcggactgacggtcgag
gtcgccgcctcgcgcgagcccgaccagcgggtggaggtcgtacggcgccggctggcgtac
gacgacgacccggccggtttcgccgcgcgctgggccgacgaggaggccgccgtacgggcg
cggatcgtgggggcgcgggaactgctgccgtcggtgcgcctgggcgacggggcgctgcgg
cagatcgcggcgacctgcgcggccttcgaggtggacggcatgcgggccgacatcgtgatg
gcgcgtacggcgaccgcgctggcggcctgggccgggcggaccgaggtgctcgccgaggac
gtgcggcaggcggccctgctcgcgctgccccaccggcggcggcgcaacccgttcgacgcg
ccggggctcgacgaggacaagctggacgagacgctggaggagttcggcgggcaggacggg
gacgggcccgacggggacgacgatcccgatccggggcccggcggcggtcccggtgggcag
cccgagcccgatgacgcgccgcagggcgatggcgacgccgccgcgcggcccgaggccggg
gagggcggcgagccgcagccgtccggctcgggtgccggggagcagcagccggcgcgtgcc
gccgagcccttccggaccaaggtgctgagcgtgccggggctcggcgagggtgccgccggg
cggcgttcgcgggcgcggaccgagcacgggcggaccacgggcgcccggcggccgcagggc
gccctgaccaagctgcacctggccgccaccgtgcaggccgccgccccgcaccagcgggcg
cggggccgcagcgggcccggtctcgtggtgcgccgggacgatctgcggcaggcgacgcgc
gaggggcgcgagggcaacctcgtgctgttcgtcgtcgacgcctccgggtcgatggccgcg
cggcagcggatgagtgccgtcaagggcgcggtgctgtcgctgctgctggacgcgtatcag
cggcgggacaaggtggggctggtgaccttccggggttcggccgcggatgtcgcgctgccg
ccgacgtcgtcggtcgacgcggcggcggtgcggctggagtcgctgccgacgggcgggcgt
acgccgctcgccgccgggctgctgcgcgcccacgaggtgctgcgggtggagcgactgcgg
gacccggcgcggcggccactgatggtcgtcgtgacggacgggcgggccacgggtggtccc
gagcccgtcgcgctggcggggcgggctgcgcggctgttcgcggccgagggcaccgcgtcc
gtggtcgtggactgcgagtcggggcccgtgcggctcgggctcgccgggcagctcgcgggt
gagctgggcggtaccgcggtgacgctggacgagctgcgggccgactcgatcgccggtctg
gtgagggacgttcagggcagcagcaggagggccgcgtaa

DBGET integrated database retrieval system