KEGG   Streptomyces coelicolor: SCO2003
Entry
SCO2003           CDS       T00085                                 

Gene name
polA, SC7H2.17c
Definition
(RefSeq) DNA polymerase I
  KO
K02335  DNA polymerase I [EC:2.7.7.7]
Organism
sco  Streptomyces coelicolor
Pathway
sco03030  DNA replication
sco03410  Base excision repair
sco03420  Nucleotide excision repair
sco03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sco00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SCO2003 (polA)
   03410 Base excision repair
    SCO2003 (polA)
   03420 Nucleotide excision repair
    SCO2003 (polA)
   03440 Homologous recombination
    SCO2003 (polA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sco03032]
    SCO2003 (polA)
   03400 DNA repair and recombination proteins [BR:sco03400]
    SCO2003 (polA)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SCO2003 (polA)
DNA replication proteins [BR:sco03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     SCO2003 (polA)
DNA repair and recombination proteins [BR:sco03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA polymerase I
     SCO2003 (polA)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     SCO2003 (polA)
SSDB
Motif
Pfam: DNA_pol_A 5_3_exonuc_N 5_3_exonuc DNA_pol_A_exo1 DNA_pol_lambd_f HHH_5 NYN_YacP HHH_2
Other DBs
NCBI-GeneID: 1097437
Kitasato: SCO2003
UniProt: Q9S2K0
Position
complement(2141659..2144382)
AA seq 907 aa
MAKTASKKTDSTSGGRPRLMLMDGHSLAYRAFFALPAENFTTATGQPTNAIYGFASMLAN
TLRDEAPTHFAVAFDVSRKTWRSEEFTEYKANRSKTPDEFKGQVELIGELLDSMHVPRFA
VEGFEADDVIATLATEAEAEGFDVLIVTGDRDSFQLVSEHTTVLYPTKGVSELTRFTPEK
VFEKYGLTPAQYPDFAALRGDPSDNLPGIPGVGEKTAAKWINQFGSFAELVERVDEVKGK
AGQNLRDHLESVKLNRRLTELERRVELPRTVTDLERTAYDRKGVAVILDTLEIRNPSLRE
RLYAVDPGAEEAEATPVVADGVELDGTVLGTGELAGWLAEHGAQPLGVATVDTWALGTGS
VTEVALAASDGKAAWFDPTELDEADETAFRSWLSDPDRPKVFHNAKGAMRVLAEHGWSVA
GVGMDTALAAYLVKPGRRSFDLDALSLEYLHRELAPAAAADGQLAFGADEGAEAEVLMVQ
ARAILDLGETFESRLADVGAADLLRDMELPTSALLARMERHGIAADREHLQAMEQMFAGA
VQQAVKEAHAAAGREFNLGSPKQLQEVLFGELNLPKTKKTKTGYTTDADALAWLAAQTDN
ELPVIMLRHREQAKLRVTVEGLIKTIAADGRIHTTFNQTVAATGRLSSTDPNLQNIPVRT
DEGRAIRRGFVVGEGFESLMTADYSQIELRVMAHLSEDAGLTEAFTSGEDLHTTAAAQVF
SVEQSAVDAEMRRKIKAMSYGLAYGLSAFGLSQQLNIEAAEARGLMDAYFERFGGVRDYL
RRVVDEARATGYTATLFGRRRYLPDLNSDNRQRREAAERMALNAPIQGTAADIVKIAMLN
VDKALREADLKSRMLLQVHDEIVLEIAPGERAAAEELVRREMANAVQLRVPLGVSVGAGP
DWESAAH
NT seq 2724 nt   +upstreamnt  +downstreamnt
gtggcgaagacagcatcgaagaagaccgacagcacctccggcggccgaccgcggctgatg
ctcatggacgggcactcgctggcgtaccgcgcgttcttcgcgctgcccgcggagaacttc
acgaccgcgacgggccagccgaccaacgcgatctacgggttcgcgtcgatgctggccaac
accctgcgtgacgaggcgcccacgcacttcgcggtggcgttcgacgtctcccgcaagacc
tggcgctccgaggagttcaccgagtacaaggcgaaccgctccaagaccccggacgagttc
aaggggcaggtggagctgatcggtgagctgctcgactccatgcacgtgccccggttcgcc
gtcgagggcttcgaggcggacgacgtcatcgccaccctcgccaccgaggccgaggccgag
ggcttcgacgtcctgatcgtcaccggcgaccgggactccttccagctggtcagcgagcac
accacggtcctctatccgaccaagggcgtctccgagctgacccgcttcaccccggagaag
gtcttcgagaagtacgggctcacccccgcccagtaccccgacttcgcggcgctgcgcggc
gacccgtccgacaacctgccgggcatcccgggcgtcggcgagaagaccgccgcgaagtgg
atcaaccagttcggatcgttcgcggagctggtcgagcgcgtcgacgaggtcaagggcaag
gccgggcagaacctgcgcgaccacctggagtccgtgaagctcaaccgccggctcaccgag
ctggagcggcgggtcgagctgccgaggaccgtcaccgacctggagcggacggcgtacgac
cgcaagggcgtcgcggtgatcctggacaccctggagatccgcaatccttcgctgcgcgag
cggctctacgccgtcgacccgggcgccgaggaggccgaggccaccccggtggtcgcggac
ggcgtggaactggacggcaccgtgctgggcacgggcgagctggccggctggctcgccgag
cacggtgcgcagccgctcggcgtggccaccgtcgacacctgggccctgggcaccggatcg
gtgaccgaggtcgcgctcgccgcgtccgacgggaaggccgcctggttcgacccgacggag
ctcgacgaggccgacgagacggcgttccgctcctggctctccgacccggaccggccgaag
gtcttccacaacgccaagggcgcgatgcgcgtcctcgccgagcacggctggagcgtcgcc
ggggtgggcatggacaccgccctggccgcctacctggtcaagccgggccggcgctccttc
gacctggacgcgctgtccctggagtacctgcaccgcgagctggcccccgccgccgcggcc
gacggacagctcgccttcggcgcggacgagggcgccgaggccgaggtgctgatggtgcag
gcccgcgccatcctcgacctgggcgagaccttcgagagccgcctggccgacgtcggcgcc
gccgacctgctgcgcgacatggagctgcccacgtccgcgctgctcgcccgcatggagcgg
cacggcatcgcggccgaccgggagcacctccaggccatggagcagatgttcgcgggcgcc
gtccagcaggcggtcaaggaggcccacgcggcggccggacgcgagttcaacctgggctcg
cccaagcagctccaggaagtcctcttcggcgagctgaacctgccgaagaccaagaagacc
aagaccggctacaccaccgacgccgacgccctggcctggctcgccgcccagacggacaac
gagctgccggtgatcatgctccgccaccgcgagcaggccaagctgcgcgtcacggtggag
ggcctgatcaagacgatcgccgcggacggccgcatccacaccacgttcaaccagacggtc
gccgcgaccggccgcctctcgtccacggacccgaacctgcagaacatcccggtccgcacc
gacgagggccgcgccatccgccgcggcttcgtggtcggcgagggattcgagtccctgatg
acggccgactacagccagatcgaactgcgcgtgatggcccacctctccgaggacgcgggc
ctgaccgaggcgttcacgtccggcgaggacctgcacaccaccgccgccgcccaggtcttc
tccgtcgagcagtcggccgtggacgcggagatgcgccgcaagatcaaggccatgtcctac
ggactcgcgtacgggctctccgccttcggcctctcccagcagctgaacatcgaggcggcc
gaggcacgcggcctgatggacgcctacttcgagcgcttcggcggcgttcgcgactatctg
cgccgggtcgtcgacgaggcacgggccacgggatacacggcgaccctcttcggccgccgc
cgctacctccccgacctcaacagcgacaaccgccagcgccgcgaggcggccgagcggatg
gccctgaacgcgccgatccagggcacggcggccgacatcgtcaagatcgccatgctcaac
gtggacaaggcgctgcgcgaggccgacctcaagtcccgcatgctcctccaggtccacgac
gaaatcgtcctggagatcgctccgggcgagcgggccgcggcggaggagctggtccgccgc
gaaatggccaacgcggtgcagctcagggtccccctgggcgtctccgtgggcgcgggcccg
gactgggaatcggcagcgcactag

DBGET integrated database retrieval system